PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g02780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 157aa    MW: 17670 Da    PI: 6.229
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g02780genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601391.6e-4371061100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +Ca+Ck+lrr+CakdC++apyfp ++p+kfa+vhk+FGasn+ k+l++l+ ++r da++slvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la++++
  CA06g02780   7 PCASCKLLRRRCAKDCIFAPYFPPHDPHKFAIVHKVFGASNINKMLQELQIQQRADAVNSLVYEANARIRDPVYGCVGAISYLQNQISQLEMQLAVAQA 105
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  CA06g02780 106 E 106
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.886107IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-437104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MGVTSSPCAS CKLLRRRCAK DCIFAPYFPP HDPHKFAIVH KVFGASNINK MLQELQIQQR  60
ADAVNSLVYE ANARIRDPVY GCVGAISYLQ NQISQLEMQL AVAQAEILCI QMQNNQDSPS  120
PNYDNNNYNL PEIQIDNDNN NLQQYLRLLE IINNSN*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576751.14e-91PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW33e-73LBD12_ARATH; LOB domain-containing protein 12
TrEMBLK4CA906e-74K4CA90_SOLLC; Uncharacterized protein
STRINGSolyc06g082310.2.12e-73(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-73LBD family protein