PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g02780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 157aa    MW: 17670 Da    PI: 6.229
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g02780genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601391.6e-4371061100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +Ca+Ck+lrr+CakdC++apyfp ++p+kfa+vhk+FGasn+ k+l++l+ ++r da++slvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la++++
  CA06g02780   7 PCASCKLLRRRCAKDCIFAPYFPPHDPHKFAIVHKVFGASNINKMLQELQIQQRADAVNSLVYEANARIRDPVYGCVGAISYLQNQISQLEMQLAVAQA 105
                 7**********************************************************************************************9998 PP

      DUF260 100 e 100
                 e
  CA06g02780 106 E 106
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.886107IPR004883Lateral organ boundaries, LOB
PfamPF031955.4E-437104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MGVTSSPCAS CKLLRRRCAK DCIFAPYFPP HDPHKFAIVH KVFGASNINK MLQELQIQQR  60
ADAVNSLVYE ANARIRDPVY GCVGAISYLQ NQISQLEMQL AVAQAEILCI QMQNNQDSPS  120
PNYDNNNYNL PEIQIDNDNN NLQQYLRLLE IINNSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4541088112LOB family transfactor Ramosa2.1
5ly0_B1e-4541088112LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576751.18e-91PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW34e-72LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A2G2Z7A41e-110A0A2G2Z7A4_CAPAN; LOB domain-containing protein 3
STRINGSolyc06g082310.2.14e-73(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.13e-73LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]