PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g01680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NAC
Protein Properties Length: 291aa    MW: 33396.7 Da    PI: 6.2419
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g01680genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.46.9e-50101371128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrF P+deel+++yL kk++++++    ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat sgyWkatgkd++v++  +ge
  CA06g01680  10 LPPGFRFYPSDEELICHYLYKKIANQEVIK-GTLIEIDLHTCEPWQLPEVAKLNSNEWYFFSFRDRKYATGFRTNRATISGYWKATGKDRTVFDPqTGE 107
                 79************************9555.6799*************88888999*************************************987889 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                 l+g++ktLvfyk+rap+g kt W+mhe+r+
  CA06g01680 108 LIGMRKTLVFYKNRAPHGIKTGWIMHEFRI 137
                 9***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-608156IPR003441NAC domain
PROSITE profilePS5100557.78410156IPR003441NAC domain
PfamPF023654.6E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGLRDIGSTL PPGFRFYPSD EELICHYLYK KIANQEVIKG TLIEIDLHTC EPWQLPEVAK  60
LNSNEWYFFS FRDRKYATGF RTNRATISGY WKATGKDRTV FDPQTGELIG MRKTLVFYKN  120
RAPHGIKTGW IMHEFRIENP HIPPKEDWVL CRVFHKGTKD ENINSTNKLS PKNMYEASVT  180
SINIMDNHEA TMPKLLPYGE AGYRPSTALS FSNNSIHQSQ NSSNLQLSQE INYKALANEM  240
IHSKCGKEDE FGFLFDMNYF EESNLQDGGV INSCLDGDMK FEDENSLVFI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-47915616165NO APICAL MERISTEM PROTEIN
1ut4_B3e-47915616165NO APICAL MERISTEM PROTEIN
1ut7_A3e-47915616165NO APICAL MERISTEM PROTEIN
1ut7_B3e-47915616165NO APICAL MERISTEM PROTEIN
3swm_A4e-47915619168NAC domain-containing protein 19
3swm_B4e-47915619168NAC domain-containing protein 19
3swm_C4e-47915619168NAC domain-containing protein 19
3swm_D4e-47915619168NAC domain-containing protein 19
3swp_A4e-47915619168NAC domain-containing protein 19
3swp_B4e-47915619168NAC domain-containing protein 19
3swp_C4e-47915619168NAC domain-containing protein 19
3swp_D4e-47915619168NAC domain-containing protein 19
4dul_A3e-47915616165NAC domain-containing protein 19
4dul_B3e-47915616165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-105HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755181e-105HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016576082.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ84TE62e-64NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A2G2Z6X90.0A0A2G2Z6X9_CAPAN; Protein CUP-SHAPED COTYLEDON 2
STRINGPGSC0003DMT4000655590.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.11e-91NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]