PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA06g00220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family GRAS
Protein Properties Length: 562aa    MW: 63667.4 Da    PI: 5.6117
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA06g00220genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS294.52.7e-901925601374
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsPilkfshlta 98 
                 lv+lLl++Ae v++++++la++ +ar    as +g+p+qRl +yf eAL++r+ ++  +  +   + +  s+  + ++  al+  +   P+ ++ +++ 
  CA06g00220 192 LVHLLLAAAEEVDQQQFHLASQSIARCLWKASATGNPIQRLCFYFGEALQERIDHKIGRSPSFErKLRFLSTLAVGTTPEALT-CHTEIPFSQVMQFAG 289
                 68***************************************************993322222220222222222333333433.55667********** PP

        GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrv 196
                  qaI+e v+g++++H +Df+i  G+Q   L+qaLa +R+++   l+iT++g+   ++kee+eetg+rL++fA++l++pf+f ++ +++++dl+ e+ +v
  CA06g00220 290 IQAIVENVKGATKIHLVDFNIRSGIQCTGLMQALAeQRDRPIELLKITAIGH---QEKEEIEETGKRLQSFANSLNLPFSFAMVFMSDMKDLTAESVNV 385
                 ***********************************66668888*********...57****************************************** PP

        GRAS 197 kpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreiv 295
                 k++E +aV +   l ++     + +++ d++++++++l+P vvvv+e ea+hns+sFl+rf+ea+ +ys+lfd++e  + r++  r+ +E + +g+ i+
  CA06g00220 386 KEDEIVAVYCYTVLRTMI----CRQDNLDNTMRVIRGLRPAVVVVCEIEANHNSPSFLNRFVEAIFFYSVLFDCFEDCMDRDNLVRKRIEVFHIGEGIR 480
                 ****************99....55555777********************************************************************* PP

        GRAS 296 nvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 n+va+egaer+ r+ +l  Wr+ + ++G+ ++++se+   qakl+l++++ +    v++  ++l+ gWk+ p+ svS W+
  CA06g00220 481 NMVAAEGAERFTRNVKLDVWRAYFARFGMVEMEVSESSRYQAKLILEQFShGSSCIVQNGGKALLVGWKGTPIKSVSIWK 560
                 **************************************************666677777788888**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.756166539IPR005202Transcription factor GRAS
PfamPF035149.4E-88192560IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MDSHEHLQEC GRNELINNSF VDPWYELDSE DLDSLYAVFD DKHHKNTSDK QVELLEDQRQ  60
NISDHWTQID DSSNMVLQVT PEASNGIQPQ VPRLGGFHDE KTNSISLASL GLLNNCGRLF  120
KKSSEENLSN VCRNEARVSN IPKLSTEEIL RIAGERYIQY STHKVDGLSM FIHPYASSLT  180
GLSIEQTKDM ELVHLLLAAA EEVDQQQFHL ASQSIARCLW KASATGNPIQ RLCFYFGEAL  240
QERIDHKIGR SPSFERKLRF LSTLAVGTTP EALTCHTEIP FSQVMQFAGI QAIVENVKGA  300
TKIHLVDFNI RSGIQCTGLM QALAEQRDRP IELLKITAIG HQEKEEIEET GKRLQSFANS  360
LNLPFSFAMV FMSDMKDLTA ESVNVKEDEI VAVYCYTVLR TMICRQDNLD NTMRVIRGLR  420
PAVVVVCEIE ANHNSPSFLN RFVEAIFFYS VLFDCFEDCM DRDNLVRKRI EVFHIGEGIR  480
NMVAAEGAER FTRNVKLDVW RAYFARFGMV EMEVSESSRY QAKLILEQFS HGSSCIVQNG  540
GKALLVGWKG TPIKSVSIWK F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-4521056021375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754450.0HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016555555.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A1U8FIG60.0A0A1U8FIG6_CAPAN; Uncharacterized protein
TrEMBLA0A2G2Z6V60.0A0A2G2Z6V6_CAPAN; DELLA protein RGL1-like
STRINGPGSC0003DMT4000187920.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.16e-46RGA-like 2