PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g16650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family SBP
Protein Properties Length: 984aa    MW: 108666 Da    PI: 7.5554
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g16650genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.41.1e-39138215178
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 +Cqv++C++dls  k+yhrrhkvC vhska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  CA05g16650 138 ICQVQDCQVDLSMSKDYHRRHKVCGVHSKAAQALVGNVMQRFCQQCSRFHVLEEFDEGKRSCRRRLAGHNKRRRKTNP 215
                 5**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-30133200IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.906136213IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-36138218IPR004333Transcription factor, SBP-box
PfamPF031101.3E-28139212IPR004333Transcription factor, SBP-box
SuperFamilySSF484034.15E-8701899IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.206.5E-9767902IPR020683Ankyrin repeat-containing domain
CDDcd002042.13E-7768902No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 984 aa     Download sequence    Send to blast
MEARDFHGPV VSNLEFGGGK KAGEWDLNDW VWDGDRFTVA PLNKEIPVVP VTTGISDVFS  60
SERSDELTLG KGKEMEKRRR TIVIEDDDDD GQNGGEDGLL NLKLGEQLYP VMEGEGEKWE  120
GKSGKKAKIG GVSSNRTICQ VQDCQVDLSM SKDYHRRHKV CGVHSKAAQA LVGNVMQRFC  180
QQCSRFHVLE EFDEGKRSCR RRLAGHNKRR RKTNPENVAN GASMNDEGGN NYLLVSLLRI  240
LANVQFNSSD QAKDQDLLSY LLRNLASLAG ANNERNVSGL LPAPSGPQNA WTSMGAPKEV  300
SLSPNGNCST IPASEVTEKR IGSTSDAERG ISRNPCAAQP GSVCCRKESL PINTNASATT  360
SAPLKLNIDL NNIYDDSQVD IQKLQNSVAF ANAGAASSAC PPSISHDPHK SSSTRTSWNS  420
GSTSSLSPSS SSGEAQSRTD RIVFKLFGKD PGELPTALRK QILDWLSHSP SNIESYIRPG  480
CIILTIYLRM DKSTWEKLYC DLNSSLRKLL NASTCSFWHT GWVYTRVNDR VAFLYNGQVV  540
LDTSLPIRSH GSCGISIIKP IAVCASESVQ FLVKGFNLSR PTTRLLCALE GKYLVQGNCI  600
DMMMEGADSC MNHEEIQSVS VPCIVPNVTG RGFIEVEDHG LSSNFFPFIV AEKDVCSEIR  660
TLESIIEFAK MTDGFLQGTQ EFQARDQALD FLHELGWLLH RSHLKFRVDS GADLNPFTFQ  720
RFKWLIDFSV DHDWCAVVKK LLDVFFNGAV DVGQESSLDV PLREVGLLHR AVRRKCRAMV  780
DVLLKYRHRG AFDLSGLQKQ QDDRGYLFRP DAVGPGGLTP LHVVASLAGC ENLLNALIDD  840
PGQVGIEAWK SARDSTGLTP NDYACLRGHY SYVHMVQKKI NEKPDDGHVV LDIPGSYGHK  900
SVKIASFQTE KSLEKPIHRQ CKQCKQILSY RNSGTSLIYK PAMLSVVGIA VICVCVALLF  960
KSLPDVHYSF RPFRWDLLKY GSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-28133212584squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016573583.10.0PREDICTED: squamosa promoter-binding-like protein 1
TrEMBLA0A1U8GXQ40.0A0A1U8GXQ4_CAPAN; Uncharacterized protein
TrEMBLA0A2G2ZJY50.0A0A2G2ZJY5_CAPAN; squamosa promoter-binding-like protein 1
STRINGSolyc05g053240.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1