PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g13060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family GeBP
Protein Properties Length: 453aa    MW: 48886.4 Da    PI: 5.4437
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g13060genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57378.98.3e-2545139297
      DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                 +f+r+w+e Dei +LqGl+   +++   +  d++ fy  +++++s  ++ksql+eK+rrL+kKf+  +++  +g ++s+ ++hdq  ++l+k++W+
  CA05g13060  45 KFHRIWTEPDEIRFLQGLVAGSSDNL-VYPRDLNVFYTRFSNNMSQPYTKSQLSEKLRRLRKKFRVVSSRLVKGFDISLLSPHDQALYDLAKQLWH 139
                 699*****************977776.5556****************************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.3E-2646139IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MDSTLPILPS SKLPIKRKTP SSPTAVAEPA VDTEPGSDPK NPPFKFHRIW TEPDEIRFLQ  60
GLVAGSSDNL VYPRDLNVFY TRFSNNMSQP YTKSQLSEKL RRLRKKFRVV SSRLVKGFDI  120
SLLSPHDQAL YDLAKQLWHP DFAYTSPFNS DKSNKSGLVG VKVRFSGNVE QPGQDGITRN  180
GVEFEGEEEL REVNVELDRG KMGGKRVEVS RLDGPVRVGV VCGIGIGDIA AKVVMDVFDE  240
CLNEFRNGVG GERSDVGSFG SGVVGEKSNL GGFGNGVVGE RSSLGGFGNG VVGERSSFGD  300
FGSGVVGERS NVDGFESGVV EERSRIGDFT NGVVGESSNL DGVRNGFVGE RSNLGGFRNA  360
VVGERSNVDD LTNGVAGERS NLGDFTNGVV GERSNVGDFT NGVVGEGSNL GGLLKEASSG  420
KFEERWREQR VAELDVLARR MRLVLEHSLQ RQ*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006360388.11e-113PREDICTED: uncharacterized protein LOC102597795
TrEMBLM1DZF31e-113M1DZF3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000968751e-112(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128221921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28040.12e-07DNA-binding storekeeper protein-related transcriptional regulator