PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g10590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 202aa    MW: 21953.1 Da    PI: 5.6966
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g10590genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.64.3e-43431421100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpee+r da++s+vyeA+ar+rdPvyG++g i +lq+q+++l+ae a++++
  CA05g10590  43 PCAACKILRRRCVEKCVLAPYFPPTEPLKFTIAHRVFGASNIIKMLQELPEEQRADAVNSMVYEANARIRDPVYGCAGAICQLQKQISELQAEFAKAHA 141
                 7***********************************************************************************************998 PP

      DUF260 100 e 100
                 e
  CA05g10590 142 E 142
                 7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.31342143IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-4343140IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MKCSDPKTIA TISSMNSSSS SFSSTVATAT SSILSTPPVI LSPCAACKIL RRRCVEKCVL  60
APYFPPTEPL KFTIAHRVFG ASNIIKMLQE LPEEQRADAV NSMVYEANAR IRDPVYGCAG  120
AICQLQKQIS ELQAEFAKAH AEIMNLKCQN SNLLALVCME VSENSSSSSL LSSDHINDYG  180
NNTSMFLEDN SVYAAWEPLW T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-45361484116LOB family transfactor Ramosa2.1
5ly0_B1e-45361484116LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755171e-96HG975517.1 Solanum lycopersicum chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016553034.11e-148PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-72LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1U8F9W31e-146A0A1U8F9W3_CAPAN; LOB domain-containing protein 1-like
STRINGSolyc05g048740.2.11e-108(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-72LOB domain-containing protein 1