PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g06710
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 286aa    MW: 33536.4 Da    PI: 10.1369
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g06710genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.27.6e-331972255
     G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                prlrWtp+LH++Fv+a+e+LGG++kAtPk +l++m+v gLt++hvkSHLQ+YR+
  CA05g06710 19 PRLRWTPDLHHCFVHAIEKLGGQDKATPKLVLQMMDVRGLTISHVKSHLQMYRS 72
                8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.5981575IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-311574IPR009057Homeodomain-like
SuperFamilySSF466891.31E-151775IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-241973IPR006447Myb domain, plants
PfamPF002495.6E-92071IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGNCGRNGGV RQYIRSKVPR LRWTPDLHHC FVHAIEKLGG QDKATPKLVL QMMDVRGLTI  60
SHVKSHLQMY RSMKNDVNRQ AERMSTQQRK HQFLEDHDCH YQKQEVVCVE QQKLLVYQHY  120
PSFSSSPMER SDSTQYFNSI LPTKRARIEV CSNQRIREAV SNQYNSRNDY IEKNGVKGER  180
AGFIWQQNSE TNRQTAHPLC NSSTTTTLFF NPLKRSNEVQ ESEFFKVHIP ISSLYTFFLF  240
FKIKLLVISL GNSLVVWVFS FLHLFYSMRL SVLLVFLESR RRQDF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-172074357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-172074458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754432e-50HG975443.1 Solanum pennellii chromosome ch04, complete genome.
GenBankHG9755162e-50HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016574578.11e-173PREDICTED: putative Myb family transcription factor At1g14600 isoform X1
TrEMBLA0A1U8H0J81e-172A0A1U8H0J8_CAPAN; Uncharacterized protein
TrEMBLA0A2G2ZH631e-172A0A2G2ZH63_CAPAN; putative Myb family transcription factor At1g14600 isoform X1
STRINGPGSC0003DMT4000756681e-111(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54332238
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.13e-34G2-like family protein