PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA05g01390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 132aa    MW: 14452.9 Da    PI: 9.5461
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA05g01390genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like50.83.8e-1631602655
     G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                +AtPk+i+++m+vkgLtl h+kSHLQkYRl
  CA05g01390 31 EATPKAIMRTMGVKGLTLFHLKSHLQKYRL 60
                7****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.3E-71963IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.1E-152761IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-113061IPR006447Myb domain, plants
PfamPF143793.4E-8104125IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 132 aa     Download sequence    Send to blast
MVAQLISAPK SLSLAGIRAF LMHMLSISLA EATPKAIMRT MGVKGLTLFH LKSHLQKYRL  60
GKQSQKDLDE ALKDGLTATY SLESPCSGGT PQQLPASDLN EGFEVKEALR AQMEVQSKLH  120
LQVEVSFLHY R*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ7191413e-53AJ719141.1 Nicotiana tabacum cDNA-AFLP-fragment BSTT2-32-460, cultivar Bright Yellow 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016571977.11e-59PREDICTED: uncharacterized protein LOC107870086 isoform X1
SwissprotQ94A578e-28PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A1U8GL363e-58A0A1U8GL36_CAPAN; Myb family transcription factor APL
TrEMBLA0A2G2ZFC53e-58A0A2G2ZFC5_CAPAN; uncharacterized protein LOC107870086 isoform X1
STRINGSolyc04g015290.2.13e-58(Solanum lycopersicum)
STRINGPGSC0003DMT4000700133e-58(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97642027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.13e-30G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]