PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g23500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family FAR1
Protein Properties Length: 674aa    MW: 76571.4 Da    PI: 7.7258
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g23500genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR190.71.9e-2834120291
        FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                 fYn+YA+++GF +r+s+ ++s r+++it+r++vCskeg++ + +++   +rr+r ++r+gCka+l +kk+ +gkw v+k+++eHnH+l+p
  CA04g23500  34 FYNSYARRLGFGTRVSAYRRSLRDNTITTRHLVCSKEGFNPKPDNA---KRRQRIVSRVGCKAHLALKKQASGKWAVSKFVKEHNHDLVP 120
                 9****************************************99888...9*************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.4E-2534120IPR004330FAR1 DNA binding domain
PfamPF105511.3E-26238328IPR018289MULE transposase domain
PROSITE profilePS5096610.781522554IPR007527Zinc finger, SWIM-type
PfamPF044344.9E-10524553IPR007527Zinc finger, SWIM-type
SMARTSM005753.7E-9529556IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 674 aa     Download sequence    Send to blast
MEDNDSSGLD LEQQCELEPY EGMEFESEQA ARIFYNSYAR RLGFGTRVSA YRRSLRDNTI  60
TTRHLVCSKE GFNPKPDNAK RRQRIVSRVG CKAHLALKKQ ASGKWAVSKF VKEHNHDLVP  120
PDQVHLIRSH RHISGPARSL IDTLQAAGLG ATGVMSVLIK QSGGISNVGF TKADCQNYMN  180
QSRQRTLGSS AQYIFDNLKQ KQAEDPDFFY AVQGGSSGNI FWADSTSRRN YSYFGDTVTF  240
DTAYRTHRYR VPFAPFIGVN HHCQPVLFGC ALLLNESESS FIWLFQNWLA AMSGRHPVSI  300
TTDHDRIIRS AIVDVFPGAR HRFCKSNIFR EAQERLSHSL QSFPTFEAEF QKCVNLTETI  360
EEYELCWGSL LGRYNVIDDE WLQSMYDARQ QWVPVYLQDT FFGETSIAKT SDNTNSYFDG  420
FIDASTNIHV LMSQYEKATA NRHEKEVKAE YDTINIAPIL KTPSPMEKQA ANIYTREIFL  480
MFQQELMETL AYPATVIKDT GSDVIYQVAK FGEDHKVNYV QYNVFEKKAS CSCQLFDFSG  540
ILCRHILAVF RVKNVLRLPS HYVLKRWTRK AKSDIVLDED KLGSPSSHNN SFTDRFEKLN  600
LEATKYVKEG VDSKNVYLVA MDALREASKK VAAAVYGTPA LPLNQDMNKA KDFNLNGNQT  660
GCDDSSLLVI FFL*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016568196.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
SwissprotQ9SZL80.0FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A1U8GA540.0A0A1U8GA54_CAPAN; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A2G2ZSZ00.0A0A2G2ZSZ0_CAPAN; protein FAR1-RELATED SEQUENCE 5-like
STRINGXP_009798613.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.10.0FAR1-related sequence 5
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]