PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g19870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family TALE
Protein Properties Length: 593aa    MW: 67139.9 Da    PI: 8.2611
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g19870genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.51.3e-093644011954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yps++++  L++++gL+++qV++WF N R +
  CA04g19870 364 FEHflHPYPSEADKHLLSRQTGLSKNQVSNWFINARVR 401
                 564459******************************88 PP

2BELL105.43.8e-34224295172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 er e q++k kLls+l+e + rY +y+eq+q++++sF+ v+g+g+a+pYt+lA+ka+SrhFrc+kdai+ q+
  CA04g19870 224 ERSEYQRRKIKLLSMLDEAYARYTRYCEQMQAMVNSFDSVIGYGAAAPYTALAQKAMSRHFRCIKDAIVAQL 295
                 789******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.5E-56157293IPR006563POX domain
PfamPF075263.3E-47163292IPR006563POX domain
PROSITE profilePS5007112.422342405IPR001356Homeobox domain
CDDcd000861.51E-11345406No hitNo description
SMARTSM003891.8E-9345409IPR001356Homeobox domain
SuperFamilySSF466895.99E-17346412IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28348411IPR009057Homeodomain-like
PfamPF059206.3E-18362401IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 593 aa     Download sequence    Send to blast
MQLPLMNPHI KPSSPPRASS SLHMLLPNSV DTNNLLHHQG FHLLNPATVE PPSQFTWIPG  60
SSSGEDDSTR IGRVVDGHGL SLSLSRNFEA AAKLEDLRIG NGGIYLQNNQ GLLSPINNNH  120
HHHHQLLHSG VVMDHRTTSP HTNVHHQIHV GYAASSPRIS NALRNSRYVK AAQELLEEFC  180
CVGRGNFKNQ RVKKYDDENP NSNSESEDHR GSSKDNHPPL SAAERSEYQR RKIKLLSMLD  240
EAYARYTRYC EQMQAMVNSF DSVIGYGAAA PYTALAQKAM SRHFRCIKDA IVAQLKQTCK  300
YLGEKDVTGT SGLTKGETPR LKVLDQKLRQ QKALHQMGML DSDAWRPQRG LPERSVNVLR  360
AWLFEHFLHP YPSEADKHLL SRQTGLSKNQ VSNWFINARV RLWKPMVEEM YQQETKEEET  420
DQEDDNQDQQ QHQQEKQAQI PMHDKTSNMA TSSTTTTMPL SSSARSEFNA NERDPSKNII  480
NYRQYALGNQ LVMLQSDDTA TTSSANPYFM XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  540
XXXXXXXXXX XXXXXAFGSQ QAGDVSLTLG LRHSENVPRK ATQFQLRDFG AY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16351409563Homeobox protein Meis2
3k2a_B1e-16351409563Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754431e-102HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016568677.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ9SW801e-129BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLK4BV620.0K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-123BEL1-like homeodomain 2