PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g15740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family GeBP
Protein Properties Length: 387aa    MW: 43506.6 Da    PI: 10.1944
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g15740genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573115.82.5e-36164259298
      DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                 lfqrlwse+De+++L+G+ d+++k++++p++d+ af+e +kks++++vsk ql +KirrLKkK+ ++  k ++gke +++k+h+qk++elskkiWg+
  CA04g15740 164 LFQRLWSEDDEVAILKGMSDYRSKKKADPVADLGAFHESIKKSLHVDVSKAQLQDKIRRLKKKYMNNAGK-EKGKERVLTKAHEQKVYELSKKIWGK 259
                 79********************************************************************.9***********************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.7E-33165258IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MKKKNPAKRW KFLRRXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXAK KPPPPQDSSS  60
SEEEESESES EPDPDPVTQK PNLLVKPIAS KPMDVPKKSS PKPRSKSDAS AKLVSPKKSS  120
STVGAKRAAG EGEAKESKKS KKKQEKEVET PVKKPVNEDV KRQLFQRLWS EDDEVAILKG  180
MSDYRSKKKA DPVADLGAFH ESIKKSLHVD VSKAQLQDKI RRLKKKYMNN AGKEKGKERV  240
LTKAHEQKVY ELSKKIWGKE KSDKGDQVEV VKVDNVAASK GRQDGGVKDN GVLFEVKEEK  300
PSAEVEKDVE VKRNLNLIPC VENVAGLEKW LEENSGVLSV EKRNAMKEKW EALKAAEADL  360
CLRRVKLIAE QMELVLEAVR DSGTET*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016570841.10.0PREDICTED: uncharacterized protein LOC107868687
TrEMBLA0A0V0I2971e-136A0A0V0I297_SOLCH; Putative mediator-associated protein 1-like
STRINGPGSC0003DMT4000792151e-135(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30421947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.12e-26DNA-binding storekeeper protein-related transcriptional regulator