PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g13620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family FAR1
Protein Properties Length: 162aa    MW: 18971.9 Da    PI: 9.9043
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g13620genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR174.81.9e-2325111190
        FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                 kfY +YA+++ Fsv++  +++s+++++i+ ++f Csk+ +r++++ +   +++ + etr gCka l ++k++++kw+v +l  +HnHela
  CA04g13620  25 KFYLDYAHRTDFSVCRGLMTRSRKDKSIIGQEFLCSKKEFRSKKDLE---RNKLQDETRDGCKALLYISKKEEDKWVVCRLIAKHNHELA 111
                 6*****************************************99888...889999********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.4E-2125111IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MYETRQIVFD TYIGKEFQSL DDSFKFYLDY AHRTDFSVCR GLMTRSRKDK SIIGQEFLCS  60
KKEFRSKKDL ERNKLQDETR DGCKALLYIS KKEEDKWVVC RLIAKHNHEL ASPNSQKFLR  120
SKRKKCEAQK NLIDLLDNSE IRPGKIASVL ITQVRGVDRL I*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-133HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015167012.11e-82PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A2G2ZPQ91e-114A0A2G2ZPQ9_CAPAN; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA645860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.12e-23FAR1-related sequence 5