PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA04g01650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 209aa    MW: 24079.9 Da    PI: 8.4777
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA04g01650genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.64.5e-3184137255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtp+LH +Fv+a+++LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  CA04g01650  84 PRLRWTPQLHLSFVNAIHRLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 137
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.09880140IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2880138IPR009057Homeodomain-like
SuperFamilySSF466893.76E-1482138IPR009057Homeodomain-like
TIGRFAMsTIGR015579.5E-2384139IPR006447Myb domain, plants
PfamPF002492.8E-985136IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MEHGNGETSE EYYMEKVMSS IDLNEEVDHD HSKIQQIDDE AIEVISVESD KITNEENNSS  60
SCGNEINIKN EMSKVRQYVR SKLPRLRWTP QLHLSFVNAI HRLGGQERAT PKLVLQMMNV  120
RGLSIAHVKS HLQMYRSKKL GEFGQVLGHG HRANQRRNYL YGNLSQRSFN PLQDFKMKNG  180
AIVLARNFND DDNINHHFQN SFARTQSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-1885139458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-1885139458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-1885139357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1885139357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1885139357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1885139357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-1885139458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-1885139458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-1885139458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-1885139458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-1885139458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-1885139458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016571767.11e-152PREDICTED: uncharacterized protein LOC107869877 isoform X1
RefseqXP_016571768.11e-154PREDICTED: putative Myb family transcription factor At1g14600 isoform X2
TrEMBLA0A1U8GSL41e-153A0A1U8GSL4_CAPAN; putative Myb family transcription factor At1g14600 isoform X2
TrEMBLA0A2G2ZL901e-151A0A2G2ZL90_CAPAN; Uncharacterized protein
STRINGXP_009607761.12e-87(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-38G2-like family protein