PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g21400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family GRF
Protein Properties Length: 491aa    MW: 53469.2 Da    PI: 6.4684
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g21400genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC702.8e-22134176244
         WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                  e+grC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e
  CA03g21400 134 VEQGRCKRTDGKKWRCSRDVAPLQKYCERHMHRGRPRSRKHVE 176
                 589**************************************98 PP

2QLQ49.11.7e-1769103236
         QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                 +FT+aQ+ +L++Q+++yKy+++   vPp+Ll+ i+
  CA03g21400  69 PFTWAQWKELERQAMIYKYMVSAISVPPDLLLSIS 103
                 9******************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009518.3E-1068104IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.91469104IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.0E-1269102IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.315133177IPR014977WRC domain
PfamPF088792.4E-18135176IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 491 aa     Download sequence    Send to blast
MMGHHHQDDG ANKMPCSSEH QNVYSDEASI VLPPVTAGGS AVVRTLQPFD ISTNNSQAAG  60
GMATTLGYPF TWAQWKELER QAMIYKYMVS AISVPPDLLL SISTNSSGAS HGVFHATLAS  120
GSVQGQRYTN VRDVEQGRCK RTDGKKWRCS RDVAPLQKYC ERHMHRGRPR SRKHVEVHAD  180
VSNASDSKKT RRRPTPMVVP AVPTHAAGQI NSHSTKQPLR STYQQIQGPL LFHDETGENI  240
STNPSFNELH RSSGWMMEGD MVAKANAAQQ WQHLMDSSAG FSADGRTHPD LQHGYREDAL  300
DLLASRDLES TEDVSVKQNG EFNFMINPES VSMGQQSLKE APISDLVNSW SNDNIYNNSN  360
DENKEASLWS SLGNISPSSL TLSIAMAAGD ALDEDMGLDS RFMNANQHKS WENSWAPFAP  420
GGPLAEALHP SSSYTSNGDS ISPAATTVSS PSGVLQKTLL SHSDGSVCNS PILAAPTNIT  480
PEMVKFHWPN *
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754424e-71HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016564282.10.0PREDICTED: growth-regulating factor 8-like isoform X1
TrEMBLA0A2G3A0350.0A0A2G3A035_CAPAN; Growth-regulating factor 5
STRINGXP_009597554.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-33growth-regulating factor 7