PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g14840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 365aa    MW: 40378.5 Da    PI: 7.9811
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g14840genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-333286155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  CA03g14840 32 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 86
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.4E-322987IPR009057Homeodomain-like
PROSITE profilePS5129412.3472989IPR017930Myb domain
SuperFamilySSF466891.67E-163187IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-233287IPR006447Myb domain, plants
PfamPF002491.1E-73484IPR001005SANT/Myb domain
PfamPF143793.5E-22128167IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010088Biological Processphloem development
GO:0010089Biological Processxylem development
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MFHAKKPSTM NSHDRPMCVQ GDSGLVLTTD PKPRLRWTVE LHERFVDAVT QLGGPDKATP  60
KTIMRVMGVK GLTLYHLKSH LQKFRLGKQP HKEFNDHSVK DGDRATSLEL QRNSASSSGM  120
IGRNMNEMQM EVQRRLHEQL EVQRHLQLRI EAQGKYMQTI LEKACQTLGG EENMALPART  180
FKGIGNQGGL IPDISAAFKE FGTPPLSFSS FQDLNICGGH DQQLELHAQS SMGERSSSFD  240
GFMNLGNTTD HNLTLGKKRP SPYSSNGGNS NGKSPFMWSD DFRLQELGVA TAAALGPNNE  300
DDHQIIQMER SCNPELDSVS DLYESKPILQ EEKKCDAKLE RPSPRRAAQI SSLSAQGGRS  360
SVFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-193288157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-193288157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-193288157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-193288157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for phloem identity. Has a dual role both in promoting phloem differentiation and in repressing xylem differentiation during vascular development. Regulates the expression of the transcription factor NAC045 (AC A4VCM0). May activate the transcription of specific genes involved in phosphate uptake or assimilation (PubMed:15592750). Promotes flowering through transcriptional activation of both FT and its transport machinery component, FTIP1 (PubMed:26239308). {ECO:0000269|PubMed:14614507, ECO:0000269|PubMed:18523061, ECO:0000269|PubMed:25081480, ECO:0000269|PubMed:26239308, ECO:0000305|PubMed:15592750}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by phosphate deficiency. {ECO:0000269|PubMed:15592750}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6869240.0JQ686924.1 Nicotiana tabacum cultivar SR1 myb family transcription factor APL (APL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016565371.10.0PREDICTED: myb family transcription factor APL isoform X5
SwissprotQ9SAK51e-129APL_ARATH; Myb family transcription factor APL
TrEMBLA0A1U8G1X90.0A0A1U8G1X9_CAPAN; Myb family transcription factor APL
TrEMBLA0A2G2ZX130.0A0A2G2ZX13_CAPAN; myb family transcription factor APL isoform X5
STRINGSolyc12g017370.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA79422231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-125G2-like family protein
Publications ? help Back to Top
  1. Martínez-Navarro AC,Galván-Gordillo SV,Xoconostle-Cázares B,Ruiz-Medrano R
    Vascular gene expression: a hypothesis.
    Front Plant Sci, 2013. 4: p. 261
    [PMID:23882276]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Kondo Y, et al.
    Vascular Cell Induction Culture System Using Arabidopsis Leaves (VISUAL) Reveals the Sequential Differentiation of Sieve Element-Like Cells.
    Plant Cell, 2016. 28(6): p. 1250-62
    [PMID:27194709]
  4. Shibuta M,Abe M
    FE Controls the Transcription of Downstream Flowering Regulators Through Two Distinct Mechanisms in Leaf Phloem Companion Cells.
    Plant Cell Physiol., 2017. 58(11): p. 2017-2025
    [PMID:29036620]