PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g14180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 177aa    MW: 19646.2 Da    PI: 5.7855
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g14180genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.22.4e-42111101100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+l+r+C+++C +apyf +++pkkfanvhk+FGasnv+k+l+++pe++red+++slvyeAe+r+rdPvyG++g i +lq+++ +l+++l ++++
  CA03g14180  11 SCAACKFLKRRCTPNCQFAPYFRSDEPKKFANVHKVFGASNVIKILNEVPEDQREDTVNSLVYEAEVRLRDPVYGCIGAIASLQRKMVELQQDLMVTRA 109
                 6********************************************************************************************999887 PP

      DUF260 100 e 100
                 +
  CA03g14180 110 H 110
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.90710111IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4111108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MKSNEPRSSS SCAACKFLKR RCTPNCQFAP YFRSDEPKKF ANVHKVFGAS NVIKILNEVP  60
EDQREDTVNS LVYEAEVRLR DPVYGCIGAI ASLQRKMVEL QQDLMVTRAH LAYYEAKPSS  120
TASNCPLLDY DPLSVNMPSV FVDTSVSGGY LDSFSQNSFV MDQSGSTNEF GQFPFP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4661146114LOB family transfactor Ramosa2.1
5ly0_B2e-4661146114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-152HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016567871.11e-129PREDICTED: LOB domain-containing protein 21-like
SwissprotQ9SRL87e-58LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A2G2ZWR81e-128A0A2G2ZWR8_CAPAN; LOB domain-containing protein 21
STRINGPGSC0003DMT4000712811e-113(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.13e-60LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]