PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g12830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family FAR1
Protein Properties Length: 840aa    MW: 96385.3 Da    PI: 7.1058
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g12830genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1872.8e-2767153291
        FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                 fY+eYAk++GF++++++s++sk+++e+++++f Cs++g + e+++    ++r+ + ++t+Cka+++vk+++dgkw ++++ ++HnHel p
  CA03g12830  67 FYQEYAKSMGFTTSIKNSRRSKKSKEFIDAKFACSRYGVTPESDTG---SSRRPSLKKTDCKASMHVKRKRDGKWFIHEFIKKHNHELLP 153
                 9***************************************999877...7888899*******************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.0E-2467153IPR004330FAR1 DNA binding domain
PfamPF105512.4E-26273365IPR018289MULE transposase domain
PROSITE profilePS5096610.101553589IPR007527Zinc finger, SWIM-type
PfamPF044341.6E-6562588IPR007527Zinc finger, SWIM-type
SMARTSM005758.2E-9564591IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010018Biological Processfar-red light signaling pathway
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 840 aa     Download sequence    Send to blast
MVDHGDVVQS NVQLTGDMVD AVDKACHSRD GGVSRSPKRN ITGVEENADV EPHDGIEFES  60
HEAAYAFYQE YAKSMGFTTS IKNSRRSKKS KEFIDAKFAC SRYGVTPESD TGSSRRPSLK  120
KTDCKASMHV KRKRDGKWFI HEFIKKHNHE LLPALAYHFR IHRNVKLAEK NNIDILHAVS  180
ERTRKMYVEM SRQCGGSQEI GLLANDLNYQ FDKGRCLSLE EGDAQVMLEY FMHIQKENPY  240
FFYAVDLNED QRLRNLFWVD AKSRKDYVSI SDVVFFDTSY MKSNEKMPFA LFIGVNHHCQ  300
PMLLGCALVA DETKPTFVWL MKTWLRAMDG QAPKVIITDQ DKSLKEAIEN IFPCSHHCFA  360
LWHVLERIPE ILAHVVKQHE NFMEKFSKCI FKSATDEQFD LRWWKMVSRF ELQENEWVHT  420
LYEDRKKWVP AYMRGRFMAG MSAAQRSESV SSFFDKYIQK KISLKEFMRQ YGMILQNRYE  480
EEAVADFDTL HKQPALKSPS PWEKQMSTIY THAIFKKFQV EVLGVVGCHP KKEAENGENV  540
TFRVDDCEKD DNFMVTWNES RSDVSCSCLL FEYKGFLCRH AMIVLQMCGL SSIPSQFILK  600
RWTKDATNVL TFEGTERIQT RVQRYNDLCR RAILLGEEGS LSEESYDIAF RVLDEALKNC  660
VNVNNRSSAL TECSSSAVGL RDLEGDTQGI HFTKTCRKKS TNKKRKVHSE PEAAIVEAED  720
SLQQMDNLTV GGMTLNGYYG THQNMQGLIQ LNLMEPPHDG YYVNQQNMQG LGHLNTATPD  780
HDGFFGSQQS VPGLGHLDFR LPSFTYGLQG TNNIQHLMSL QDEPSLRGAQ LHGNNARHA*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that recognizes and binds to the DNA consensus sequence 5'-CACGCGC-3'. Activates the expression of FHY1 and FHL involved in light responses. Positive regulator of chlorophyll biosynthesis via the activation of HEMB1 gene expression. {ECO:0000269|PubMed:11889039, ECO:0000269|PubMed:12753585, ECO:0000269|PubMed:18033885, ECO:0000269|PubMed:22634759}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00434DAPTransfer from AT4G15090Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated after exposure to far-red light. Subject to a negative feedback regulation by PHYA signaling. {ECO:0000269|PubMed:18033885}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016565037.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_016565038.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_016565039.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_016565040.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_016565042.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_016565043.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_016565044.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_016565045.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
RefseqXP_016565046.10.0PREDICTED: protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
SwissprotQ9SWG30.0FAR1_ARATH; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLA0A1U8G0T10.0A0A1U8G0T1_CAPAN; Protein FAR-RED IMPAIRED RESPONSE 1
TrEMBLA0A1U8G0Z80.0A0A1U8G0Z8_CAPAN; protein FAR-RED IMPAIRED RESPONSE 1 isoform X1
STRINGSolyc08g060840.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49621103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G15090.10.0FAR1 family protein
Publications ? help Back to Top
  1. Domergue F, et al.
    Three Arabidopsis fatty acyl-coenzyme A reductases, FAR1, FAR4, and FAR5, generate primary fatty alcohols associated with suberin deposition.
    Plant Physiol., 2010. 153(4): p. 1539-54
    [PMID:20571114]
  2. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  3. Wang C, et al.
    SCAB3 Is Required for Reorganization of Actin Filaments during Light Quality Changes.
    J Genet Genomics, 2015. 42(4): p. 161-8
    [PMID:25953354]
  4. Wang W, et al.
    A pair of light signaling factors FHY3 and FAR1 regulates plant immunity by modulating chlorophyll biosynthesis.
    J Integr Plant Biol, 2016. 58(1): p. 91-103
    [PMID:25989254]
  5. Ma L, et al.
    Arabidopsis FHY3 and FAR1 Regulate Light-Induced myo-Inositol Biosynthesis and Oxidative Stress Responses by Transcriptional Activation of MIPS1.
    Mol Plant, 2016. 9(4): p. 541-57
    [PMID:26714049]
  6. Siddiqui H,Khan S,Rhodes BM,Devlin PF
    FHY3 and FAR1 Act Downstream of Light Stable Phytochromes.
    Front Plant Sci, 2016. 7: p. 175
    [PMID:26941752]
  7. Liu L,Li B,Liu X
    FAR-RED ELONGATED HYPOCOTYL3 promotes floral meristem determinacy in Arabidopsis.
    Plant Signal Behav, 2016. 11(10): p. e1238545
    [PMID:27660915]
  8. Ma L,Xue N,Fu X,Zhang H,Li G
    Arabidopsis thaliana FAR-RED ELONGATED HYPOCOTYLS3 (FHY3) and FAR-RED-IMPAIRED RESPONSE1 (FAR1) modulate starch synthesis in response to light and sugar.
    New Phytol., 2017. 213(4): p. 1682-1696
    [PMID:27859295]
  9. Liu Y, et al.
    Light and Ethylene Coordinately Regulate the Phosphate Starvation Response through Transcriptional Regulation of PHOSPHATE STARVATION RESPONSE1.
    Plant Cell, 2017. 29(9): p. 2269-2284
    [PMID:28842534]
  10. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]