PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g07840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family GRAS
Protein Properties Length: 563aa    MW: 63200.8 Da    PI: 6.2047
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g07840genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS239.31.7e-731845612374
        GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                 ++lL  cA a++ g+++ +q+lL  l+elas +gd++ Rlaa+ ++AL ++l++   +l+++  +++ ++ n++    +l  f+++sP++++ + +aN+
  CA03g07840 184 EHLLNPCAAAITVGNMNHVQHLLYVLHELASFTGDANYRLAAHGLRALTHHLSS-PGSLSASAGVTNFASANHKFFRDSLINFNDISPWFRIPNNIANS 281
                 699**************************************************9.445555566666666677777777777***************** PP

        GRAS 101 aIleavege...ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLakfAeelgvpfefnvlvakrl 186
                  +l+ + ++   +++Hi+D+++s+G+QWp+Ll++L+ R+ ++pp +R+T++ +  ++                  ++L +fA+++++++++n l    l
  CA03g07840 282 SVLQIIGEQdqlKKLHILDIGVSHGVQWPTLLEELTRRSgGPPPLVRLTVITPTIENgelrgtpfvIGPPGYDFSSQLLSFAKAININLQINRLDNFPL 380
                 ******999777888************************55666********9766678888888877888999*******************8777** PP

        GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe..adhns.esFlerflealeyysalfdsleaklpreseer 282
                 ++l+ + ++ +++E+l+++ +++lh+l    ++ ++er+e+Lk++ksl Pk +v++e++  +++ns ++F++ f++ +ey + ++ds+++ +    + r
  CA03g07840 381 QNLNSQVINSSSDETLVICAQFRLHNLN---HANPDERTELLKILKSLDPKGLVLSENNteCSCNScGDFATTFSRRVEYLWRFLDSTSVAY----KGR 472
                 ***************************8...77777889******************983355555269*******************8885....667 PP

        GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  + Er+++++e+ +++++ g+     +e++ekW er++++GF +  ++e++ + a++llrk++ ++++rvee++g++ l Wk++p+ ++S W+
  CA03g07840 473 ESEERRMMEEEAAKALTNTGEL----NERKEKWCERMRSVGFVKDVFGEDVIDGARALLRKYDsNWEMRVEEKDGCVDLWWKGQPISFCSLWK 561
                 7777777777799999999998....88888********************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.74157540IPR005202Transcription factor GRAS
PfamPF035145.8E-71184561IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MFKHQNILST HSSTRFCDTM AIDESEPNSN FDSISEWLAS TLSDIPSFLD EPYSYIDDLN  60
FYGDSLWVTD QDDHIVNHNI ILDNTCNSFN NSSPVNTSTS NIPSEPIILN HPQPLDLSKK  120
RKTSSSDHNP KASRKNQNRQ MNEAEDAHAV VEPGVQLRRS TGPKRVTTKS TGNNSSNKEG  180
RWAEHLLNPC AAAITVGNMN HVQHLLYVLH ELASFTGDAN YRLAAHGLRA LTHHLSSPGS  240
LSASAGVTNF ASANHKFFRD SLINFNDISP WFRIPNNIAN SSVLQIIGEQ DQLKKLHILD  300
IGVSHGVQWP TLLEELTRRS GGPPPLVRLT VITPTIENGE LRGTPFVIGP PGYDFSSQLL  360
SFAKAININL QINRLDNFPL QNLNSQVINS SSDETLVICA QFRLHNLNHA NPDERTELLK  420
ILKSLDPKGL VLSENNTECS CNSCGDFATT FSRRVEYLWR FLDSTSVAYK GRESEERRMM  480
EEEAAKALTN TGELNERKEK WCERMRSVGF VKDVFGEDVI DGARALLRKY DSNWEMRVEE  540
KDGCVDLWWK GQPISFCSLW KM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B4e-3218056184473Protein SHORT-ROOT
5b3h_B2e-3218056130419Protein SHORT-ROOT
5b3h_E2e-3218056130419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016562454.10.0PREDICTED: nodulation-signaling pathway 1 protein-like
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A1U8G3930.0A0A1U8G393_CAPAN; nodulation-signaling pathway 1 protein-like
STRINGPGSC0003DMT4000896920.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49492139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-145GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]