PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g01170
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 294aa    MW: 32657.4 Da    PI: 6.9976
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g01170genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.22.1e-344599155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprlrWt+eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYR+
  CA03g01170 45 KPRLRWTTELHERFVDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKYRM 99
                79****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.48742102IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.2E-3343100IPR009057Homeodomain-like
SuperFamilySSF466892.33E-1744101IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-2445100IPR006447Myb domain, plants
PfamPF002497.3E-94798IPR001005SANT/Myb domain
PfamPF143791.8E-26144190IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MYSTLPIRSL GIEESGDFFN LQGCLSVDGT NLPGDSCVVL STDPKPRLRW TTELHERFVD  60
AVTQLGGPDK ATPKTIMRTM GVKGLTLYHL KSHLQKYRMG KQSAKEGTEN SKDGNEELLI  120
KYYSFPQIAL ISSVLLNLFN RGLQVTEALR VQMEVQRRLH EQLEVQRRLQ FRIEAQGKYL  180
QSILEKACKA FNSQSLESNG LEMNGEDLPA LATKVANDCE GIITVPSLPE IGSSIENRNA  240
CHLPARLGDC MLDDCLPSNG IGALKKRPRA FTNANGLPME SNTREVEWMM SNI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-2045101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-2045101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-2045101157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-2045101157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754485e-63HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755215e-63HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016566382.10.0PREDICTED: myb family transcription factor APL-like
SwissprotQ94A572e-95PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A1U8G4T80.0A0A1U8G4T8_CAPAN; Myb family transcription factor APL
TrEMBLA0A2G2ZTQ10.0A0A2G2ZTQ1_CAPAN; myb family transcription factor APL-like
TrEMBLA0A2G3CRI60.0A0A2G3CRI6_CAPCH; Myb family transcription factor APL
STRINGXP_009619230.11e-163(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.17e-98G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]