PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g30000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 164aa    MW: 18337.6 Da    PI: 7.2995
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g30000genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.89.2e-4411109199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++++ ++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el+++++
  CA02g30000  11 PCAACKFLRRKCLPGCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEIQAHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVIRLQKELDATNA 109
                 7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.97410111IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-4311108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MASSSSYSNP PCAACKFLRR KCLPGCIFAP YFPPEEPQKF ANVHKIFGAS NVSKLLNEIQ  60
AHQREDAVNS LAYEAEARMK DPVYGCVGAI SVLQRQVIRL QKELDATNAD LMRYANREVN  120
NQQRNLNYGR SGIDQTHYGY CVPSYIPPNT TWNNPEADDD SNM*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016562307.11e-121PREDICTED: LOB domain-containing protein 25
RefseqXP_016562308.11e-121PREDICTED: LOB domain-containing protein 25
RefseqXP_016562309.11e-121PREDICTED: LOB domain-containing protein 25
RefseqXP_016562310.11e-121PREDICTED: LOB domain-containing protein 25
SwissprotQ9FML41e-67LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLM1AY892e-92M1AY89_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000328755e-92(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.46e-69LBD family protein