PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g25780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 369aa    MW: 41724.9 Da    PI: 8.3089
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g25780genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.92e-32239294156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rFv+a++qLGG+++AtPk+i+++m+v+gLt+++vkSHLQkYRl+
  CA02g25780 239 KQRRCWSPELHRRFVDALHQLGGAQVATPKQIRDIMQVDGLTNDEVKSHLQKYRLH 294
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-30236297IPR009057Homeodomain-like
PROSITE profilePS5129414.047236296IPR017930Myb domain
SuperFamilySSF466891.88E-17237297IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-26239294IPR006447Myb domain, plants
PfamPF002491.6E-7241292IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGSNSREMDI DLNFIYVPKI ISDVLTEISA MDDISKKLIK LNQFIIALEE ELRKIEAFKR  60
ELPFXFFFFF SIERLKEEAL QYKGKDKKPV MEKFISLKKG NSDESGRVKK SNDLNDKKNW  120
MSSAQLWSTP VQYEQSYDLE KQGPFLHLNS GGLEEKNKEK EYQLGVHKLK SDRGAFLPFQ  180
GQTLKEGKNG LPVKDLSLCM AVTVAEGQKG QNPIDLSVKN DNGTSNGCSF LQDKSQQRKQ  240
RRCWSPELHR RFVDALHQLG GAQVATPKQI RDIMQVDGLT NDEVKSHLQK YRLHVRRVPV  300
SGCSWSNMDE IGELSKTNGT QSGSPEGPLH FTGSGSAKGV SMNEEEDNKS ESYTWNGQHQ  360
KSNIEAHV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-14239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-14239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-14239292154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-14239292154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-14239292154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-14239292154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-14239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-14239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-14239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-14239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-14239292255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-14239292255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754412e-69HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016561132.10.0PREDICTED: two-component response regulator-like APRR2
TrEMBLA0A1U8FPI00.0A0A1U8FPI0_CAPAN; two-component response regulator-like APRR2
STRINGPGSC0003DMT4000260960.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA84972229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.13e-47G2-like family protein