PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g21940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family SRS
Protein Properties Length: 206aa    MW: 22315.4 Da    PI: 8.1197
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g21940genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702224.52.1e-6961673155
      DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.aeaaskrkrel.........kskkqsalsstkl 91 
                  g++sCqdCGnqakkdC+h+RCRtCCksrgf+C+thv+stWvpaakrrerq+qla++++++++++ ++++++++r+l         +  ++s+l +t++
  CA02g21940   6 GGGISCQDCGNQAKKDCQHMRCRTCCKSRGFQCQTHVRSTWVPAAKRRERQNQLATLQHHQEEEQhQQQQQQETRQLhrdnpkrlrEDPSASSLVCTRI 104
                 5789*****************************************************999888774333333333335566666544455667777776 PP

      DUF702  92 ssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGleek 155
                   + s++ le+ ++P++v s+avf+cvr+ssvdd+e+++aYqtav+igGhvfkGiLydqG+e++
  CA02g21940 105 LPS-STSGLEVGNFPAKVTSNAVFHCVRMSSVDDAEDQFAYQTAVNIGGHVFKGILYDQGPENQ 167
                 665.455899999************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.6E-668165IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.3E-271052IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016245.3E-27117164IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MMRSGGGGIS CQDCGNQAKK DCQHMRCRTC CKSRGFQCQT HVRSTWVPAA KRRERQNQLA  60
TLQHHQEEEQ HQQQQQQETR QLHRDNPKRL REDPSASSLV CTRILPSSTS GLEVGNFPAK  120
VTSNAVFHCV RMSSVDDAED QFAYQTAVNI GGHVFKGILY DQGPENQYMA AGESSSGGGS  180
ASHQHNLIGA AGTSTSAATS GXCST*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC3319120.0KC331912.1 Solanum lycopersicum expression of terpenoids 3 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016560706.11e-148PREDICTED: protein SHI RELATED SEQUENCE 1-like
SwissprotQ9SD401e-67SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLA0A0V0IDY81e-109A0A0V0IDY8_SOLCH; Uncharacterized protein
STRINGSolyc02g084680.2.11e-102(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67824110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.14e-67Lateral root primordium (LRP) protein-related