PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g20100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family FAR1
Protein Properties Length: 73aa    MW: 8558.71 Da    PI: 9.0884
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g20100genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR137.77e-123271140
        FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegk 40
                kfY +YA++ GF+vrk++ ++s+ +++i++++fvCske +
  CA02g20100 32 KFYLDYAHRSGFNVRKNRISRSRIDKSIIDQEFVCSKEEF 71
                6************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.8E-93271IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
MAVVPFTPQF GDEESRVPYI SMKFQSPDVA YKFYLDYAHR SGFNVRKNRI SRSRIDKSII  60
DQEFVCSKEE FR*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754424e-42HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025884696.13e-31protein FAR1-RELATED SEQUENCE 11-like
RefseqXP_025884722.13e-30protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A2G3A9R21e-45A0A2G3A9R2_CAPAN; Uncharacterized protein
STRINGSolyc02g092170.1.19e-32(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA645860