PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g18420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 104aa    MW: 11481 Da    PI: 7.0715
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g18420genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like82.64.3e-2651100251
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                 prlrWt +LH++Fv+ave  GG ++AtPk +l++m+vkgL +++vkSHLQ
  CA02g18420  51 PRLRWTDDLHHHFVNAVELAGGVDRATPKMVLQVMDVKGLNVNQVKSHLQ 100
                 8************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-2447100IPR009057Homeodomain-like
PROSITE profilePS512949.06747103IPR017930Myb domain
SuperFamilySSF466891.16E-1249102IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-2051103IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MNKGLFDMSE NSSENVSCDL SLSLSHAAQQ NVLESSNDNS GVRSYVRSKM PRLRWTDDLH  60
HHFVNAVELA GGVDRATPKM VLQVMDVKGL NVNQVKSHLQ VIF*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016560138.15e-67PREDICTED: two-component response regulator ARR10-like
SwissprotQ700D92e-22MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A1U8FUP21e-65A0A1U8FUP2_CAPAN; two-component response regulator ARR10-like
STRINGXP_009623365.12e-29(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74502029
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.14e-26G2-like family protein