PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g15750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family Dof
Protein Properties Length: 278aa    MW: 31358.1 Da    PI: 5.1405
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g15750genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1115.5e-354097360
      zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                 + lkcprCds ntkfCyynny+ sqPr++Ck+C+r+Wt+GG+lrnvPvGggr++++ 
  CA02g15750 40 PEPLKCPRCDSINTKFCYYNNYNKSQPRHYCKGCKRHWTEGGTLRNVPVGGGRKNKRM 97
                6789***********************************************9776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-233696IPR003851Zinc finger, Dof-type
PfamPF027017.3E-314295IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.0464397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGLSTKLVSI DDDGLDDWTC SSQNSLPEPP LIRRQPPSKP EPLKCPRCDS INTKFCYYNN  60
YNKSQPRHYC KGCKRHWTEG GTLRNVPVGG GRKNKRMRMT TDLVDHITGR KRVTLEEMND  120
QRCPLISTTI TNTTTSSMPS TIISNMDEDI KNIPSLASSS LPYDIFSSLK LSSIPQDGNT  180
HFSLIPNSST TQLSSNVYCN YDYMGKFDST MEESTITTVM PITSSSDLFS QPWKVPETSN  240
DFIIENMSSN YWNWNEFDTL STAADLNIQW DDLEIKP*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-107HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016562070.10.0PREDICTED: dof zinc finger protein DOF4.6-like
TrEMBLM1C1N11e-141M1C1N1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000577821e-141(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07640.12e-29Dof family protein