PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g14000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 367aa    MW: 42721.9 Da    PI: 8.7988
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g14000genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.1e-3264117255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtpeLH++Fv+a+++LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  CA02g14000  64 PRLRWTPELHRSFVQAIQRLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 117
                 8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.8E-2960118IPR009057Homeodomain-like
PROSITE profilePS5129412.78660120IPR017930Myb domain
SuperFamilySSF466892.69E-1563118IPR009057Homeodomain-like
TIGRFAMsTIGR015579.5E-2464119IPR006447Myb domain, plants
PfamPF002492.6E-965116IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MIMENSSSSS IDLNEDNKGE SEEEEEEVIE VEDSSEKETE RISNYNSCDV EKKNVRQYVR  60
SKLPRLRWTP ELHRSFVQAI QRLGGQERAT PKLVLQMMNV RGLSIAHVKS HLQMYRSKKL  120
DESGQVLGRG NNRGMQGRGY FFRNHLGGQR YNPIQDFKMN GAIVLARNFN YDDHALKGHF  180
RNSFSRPPYQ SKGIISRYMQ WSSDNQGGLC NTTKSLQGED LLRMKSWQTP RQAVIEENGI  240
HDIVPIRSTQ FLEQKKWPPF IPNQWEEKRA DFCSAKNSHF WLQQNLGQPY SKWKYCRNNN  300
ALEQNLVTPF TFEMKQDKSP LEEKDWLPDL QLRLSRSTED KNESNRRDQS DINTMLSLSL  360
PTYSAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-1965119357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-1965119357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-1965119357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-1965119357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754418e-44HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016562028.10.0PREDICTED: uncharacterized protein LOC107861178
RefseqXP_016562029.10.0PREDICTED: uncharacterized protein LOC107861178
TrEMBLA0A2G3A8860.0A0A2G3A886_CAPAN; Uncharacterized protein
STRINGPGSC0003DMT4000264190.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.17e-36G2-like family protein