PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g04240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family VOZ
Protein Properties Length: 334aa    MW: 37384.3 Da    PI: 6.2614
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g04240genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ416.16.4e-128532721217
         VOZ   1 pppsaflgpkcalwdctrpaqgsewlq...dycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf 96 
                 pppsaflgpkcalwdc+rpa gs+w+q   dycs +ha+la neg +g  pv+rp g++lkd+llf+alsak+qgk+vg+pec+gaatakspwna+elf
  CA02g04240  53 PPPSAFLGPKCALWDCPRPAMGSDWCQkshDYCSDYHAALAPNEGFLGRPPVVRPMGVGLKDSLLFQALSAKAQGKDVGVPECKGAATAKSPWNAPELF 151
                 89***********************976668******************************************************************** PP

         VOZ  97 dlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekks 195
                 dl+++egetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+++gglkrsyymdpqp++++ewhlyeyein++da alyrlelklvd+kks
  CA02g04240 152 DLEVVEGETIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQVMNDYGGLKRSYYMDPQPMKNLEWHLYEYEINKYDAWALYRLELKLVDGKKS 250
                 *************************************************************************************************** PP

         VOZ 196 akgkvskdsladlqkklgrlta 217
                 +kgkv+k+s+adlqk++grlta
  CA02g04240 251 PKGKVTKESVADLQKRMGRLTA 272
                 ********************97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MPSVDNNAGI NNLGVATQLD YHSFDPQQDF DQFGFDALNL CLEDDLPPIQ ISPPPSAFLG  60
PKCALWDCPR PAMGSDWCQK SHDYCSDYHA ALAPNEGFLG RPPVVRPMGV GLKDSLLFQA  120
LSAKAQGKDV GVPECKGAAT AKSPWNAPEL FDLEVVEGET IREWLFFDKP RRAFESGNRK  180
QRSLPDYNGR GWHESRKQVM NDYGGLKRSY YMDPQPMKNL EWHLYEYEIN KYDAWALYRL  240
ELKLVDGKKS PKGKVTKESV ADLQKRMGRL TAEFPLENKR IVKGRAKSNT KDVATNVHAA  300
PNQTVPVIEG FDYVAGAPFP DYLVDNLGGY YIT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016559800.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-142VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A1U8FM450.0A0A1U8FM45_CAPAN; transcription factor VOZ1-like
STRINGPGSC0003DMT4000812410.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-142vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]