PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g01670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 231aa    MW: 25854.3 Da    PI: 6.865
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g01670genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.31.1e-4271061100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC+++Cv+apyfp +qp kfanvhk+FGasnv kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+q++ +l ++k+
  CA02g01670   7 PCAACKFLRRKCTQECVFAPYFPPDQPLKFANVHKVFGASNVAKLLNELNATQREDAVNSLAYEAEYRLRDPVYGCVGLISILQHKLKQVQDDLLTAKK 105
                 7********************************************************************************************999988 PP

      DUF260 100 e 100
                 e
  CA02g01670 106 E 106
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.4746107IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-427104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPLKFANVH KVFGASNVAK LLNELNATQR  60
EDAVNSLAYE AEYRLRDPVY GCVGLISILQ HKLKQVQDDL LTAKKELATY IGPQAMLPML  120
QHSGYLQQHP NNPSSSTMMP YNMPPTLGMP TGMQQHGGQL IMRDPQQQQQ QQNHQQVIEA  180
HQLAAVMAAT REQQDMMRTY EQQPPPQQQQ FNGGFDSAGS ITDENPQFFI *
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754410.0HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016558921.11e-144PREDICTED: LOB domain-containing protein 36-like
RefseqXP_016558920.11e-144PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ34e-79LBD36_ARATH; LOB domain-containing protein 36
TrEMBLK4B6V01e-128K4B6V0_SOLLC; Uncharacterized protein
STRINGSolyc02g065150.1.11e-128(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-79ASYMMETRIC LEAVES 2-like 1