PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g00820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 165aa    MW: 18288.8 Da    PI: 7.7857
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g00820genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.71.3e-45111101100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+C +dCv+apyfpa++p+kfanvhk+FGasnv+k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++la++++
  CA02g00820  11 PCAACKLLRRRCGHDCVFAPYFPADEPHKFANVHKVFGASNVSKMLQELPEHKRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDMLRTQLAMAQA 109
                 7**********************************************************************************************9987 PP

      DUF260 100 e 100
                 e
  CA02g00820 110 E 110
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.710111IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-4511108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MKECGKNSSS PCAACKLLRR RCGHDCVFAP YFPADEPHKF ANVHKVFGAS NVSKMLQELP  60
EHKRGDAVSS MVYEANARVR DPVYGCVGAI SSLQQQIDML RTQLAMAQAE VVQLRLRQST  120
GIINNSPPNN DSPITSSQPK GYSHFHMDLD VDQSNCFNEP MWPY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4871277127LOB family transfactor Ramosa2.1
5ly0_B2e-4871277127LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755142e-82HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016561978.11e-122PREDICTED: LOB domain-containing protein 4
SwissprotQ9SHE91e-61LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A1U8G0351e-121A0A1U8G035_CAPAN; LOB domain-containing protein 3
TrEMBLA0A2G2XDT11e-121A0A2G2XDT1_CAPBA; LOB domain-containing protein 3
TrEMBLA0A2G2Y2951e-121A0A2G2Y295_CAPAN; LOB domain-containing protein 4
STRINGSolyc02g069440.2.11e-108(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.17e-64LOB domain-containing protein 4