PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g34570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family ARF
Protein Properties Length: 576aa    MW: 64465.9 Da    PI: 7.2008
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g34570genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.51.2e-2390190198
                 EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                 f kvlt sd++++g +++ +k+a+e+     + +++  ++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv++++L +gD++vF   +++++e ++
  CA01g34570  90 FYKVLTASDTSTHGGFSIFRKHANEClppldMTQPTPAQELVAKDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVSSKRLVAGDSFVFL--RSEKGEVRI 186
                 789***************************9666666779************************************************..458999999 PP

                 EEE- CS
          B3  95 kvfr 98 
                 +++r
  CA01g34570 187 GIRR 190
                 9998 PP

2Auxin_resp98.59.6e-33216295183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha++t+++  v+Y+Pr+  s+F+v ++k+++a+++++svGmRfkm+fe+e+++e r++Gt+vgv+d ++++W++S+WrsLk
  CA01g34570 216 ASHAVATQTMLVVYYKPRT--SQFIVGLNKYLEAVNHRYSVGMRFKMHFEGEEVPESRFTGTIVGVED-SSSQWKDSQWRSLK 295
                 789***************6..9**********************************************.555*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.31E-3781219IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.9E-4082205IPR015300DNA-binding pseudobarrel domain
CDDcd100172.73E-1888190No hitNo description
PROSITE profilePS5086312.16790192IPR003340B3 DNA binding domain
SMARTSM010194.6E-2090192IPR003340B3 DNA binding domain
PfamPF023621.2E-2190190IPR003340B3 DNA binding domain
PfamPF065074.5E-31216295IPR010525Auxin response factor
PfamPF023092.3E-6460506IPR033389AUX/IAA domain
SuperFamilySSF542774.81E-11466546No hitNo description
PROSITE profilePS5174522.8470551IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MLNPLSSNPD SASVRDKLEA STNRELNQRM PMFNLQPKIL CRVLDIQLMA EQDTDEVYAQ  60
ITLLPEADQV EPTNPDPSPP EPPRPKVHFF YKVLTASDTS THGGFSIFRK HANECLPPLD  120
MTQPTPAQEL VAKDLHGFEW RFKHIFRGQP RRHLLTTGWS TFVSSKRLVA GDSFVFLRSE  180
KGEVRIGIRR LVCQPCSMPQ SMISSQSMHL GVLATASHAV ATQTMLVVYY KPRTSQFIVG  240
LNKYLEAVNH RYSVGMRFKM HFEGEEVPES RFTGTIVGVE DSSSQWKDSQ WRSLKVQWDE  300
PASVSRPDRV SPWDIEPFVA PVTSPLVHPM SVKNKRHRPH NEPKVSGGNK HSLNMFFDET  360
EANKIASPRP AFTSFASSQF GKQNDERKGD TIISCRLFGI DLKSPSLGSA IENRTLKPAN  420
NSDNSAEGCF GNTTSAGDSQ DNSGLSKDQK HEHLHLPLNE VHGKQICSTR SRTKVHMQGV  480
AVGRAVDLTV LSGYDELVKE LKEMFDIQEE LHARNKWEIV FTDGEGDVML MGDHPWPEFC  540
NVAKKIFICP SQDKKSFSAE TKSPSCLDSE TTTSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1451631850355Auxin response factor 1
4ldw_A1e-1451631850355Auxin response factor 1
4ldw_B1e-1451631850355Auxin response factor 1
4ldx_A1e-1451631850355Auxin response factor 1
4ldx_B1e-1451631850355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM5651270.0HM565127.1 Solanum lycopersicum auxin response factor 12 (ARF12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016552491.10.0PREDICTED: auxin response factor 9-like
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A1U8F1G40.0A0A1U8F1G4_CAPAN; Auxin response factor
TrEMBLA0A2G3APD10.0A0A2G3APD1_CAPAN; Auxin response factor
STRINGSolyc08g008380.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9