PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g28430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family CO-like
Protein Properties Length: 358aa    MW: 40154 Da    PI: 6.5028
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g28430genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.35.6e-071352639
    zf-B_box  6 CpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                C+ ++  + + fC+ +  +lC +C +++H        H +
  CA01g28430 13 CDACKAAPSTVFCKADMAFLCLTCDSKIHAAnklasrHAR 52
                *****************************65566666655 PP

2zf-B_box24.84.4e-085498442
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                 +C+ +e+ +++  C+ +   lC +C + +H+       H++vp+
  CA01g28430 54 LVCEVCEHAPASVTCKADAAALCITCDQDIHSAnplarrHERVPV 98
                68*****************************66899999*99986 PP

3CCT68.91.3e-23278321144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea++lRY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++
  CA01g28430 278 REARVLRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRT 321
                 9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.1E-11855IPR000315B-box-type zinc finger
PROSITE profilePS501199.684855IPR000315B-box-type zinc finger
CDDcd000214.61E-71355No hitNo description
PROSITE profilePS5011911.1215198IPR000315B-box-type zinc finger
PfamPF006434.4E-65498IPR000315B-box-type zinc finger
CDDcd000216.83E-85598No hitNo description
SMARTSM003362.1E-95698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.797278320IPR010402CCT domain
PfamPF062031.6E-17278320IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MVVESWSTTA KGCDACKAAP STVFCKADMA FLCLTCDSKI HAANKLASRH ARVLVCEVCE  60
HAPASVTCKA DAAALCITCD QDIHSANPLA RRHERVPVVP FYDSSSARSQ TADDENDPPR  120
LQFEEEEAEA ESWLLQAPNN NQEADEYKSS AAAEYLFGDV DSYVKVDMVS DQKPSNKANT  180
DIQLHQDCVV PHVENKNTEI QLHGPVVDGY PSYEMDFSAG CKPFMYNFST QSISQSVSSS  240
SMEVGVVPDH NTMTDVSTTF VRNSVIDGLP NPISSSDREA RVLRYREKRK NRRFEKTIRY  300
ASRKAYAETR PRIKGRFAKR TESDVVDSLV XGCRHFIWRR SFVLIIWKVY FMLLMKE*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016549087.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-89COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A2G3ANF50.0A0A2G3ANF5_CAPAN; Uncharacterized protein
STRINGPGSC0003DMT4000676571e-173(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.13e-88CONSTANS-like 4