PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g23320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family GRAS
Protein Properties Length: 590aa    MW: 67293 Da    PI: 4.7921
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g23320genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3037.1e-932175871374
        GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn....sseelaalkl.fsevsPilkfs 94 
                 lv+ Ll+++e v++++++la++l++r    as +g+p+qRl +yf++AL++r++rs+ +   + + ++    +     s  ++a++l  +++ P+ ++ 
  CA01g23320 217 LVHHLLAAVEEVNNQQFHLASKLISRCMWVASDSGTPVQRLSFYFAKALEERIHRSTGRYTCTDEDRHL---KyiktKSLGTNATSLtCHQLIPFNQVM 312
                 6899***************************************************44333322222222...122222222333333699********* PP

        GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                 +++a q+I+e v++++++H iDf+i  G+QW+ L+qaLa++  ++   l+iT+vgs   ++ke++e tg+ L++fA++lg+pf+f+++ +++++d++ e
  CA01g23320 313 QFAAVQTIVENVKSAKKIHLIDFNIRSGIQWIVLIQALAEKGdSPIELLKITAVGS---TEKENYEVTGNTLHSFAKSLGLPFSFDIVFVSDMKDFKKE 408
                 ****************************************98344559********...579************************************* PP

        GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
                 +++++++E++aV l + l ++  ++ +l    d+++k+v+s++P+v+vv e ea+hns+sFl+rf+e+l +ysa+fd++e  + r+s  r+++E++++g
  CA01g23320 409 SINIETDETVAVYLNFILRTMIPRPDCL----DNLMKVVRSIRPTVIVVGEVEANHNSPSFLNRFIETLFFYSAFFDCFEDCMDRDSPCRTTIEEVYFG 503
                 ****************999999555555....55***************************************************************** PP

        GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                 + ++n+va+eg++r+ r+ +le Wr+ +e++G+ + +lse+   qa+l+l++++ s    ++++ + l++gWk+ p+ s+S W+
  CA01g23320 504 EGVRNIVAAEGEDRFTRNVKLEVWRAFFERFGMMEEELSESSWYQADLILKQFAqSSSCDLHKDGKGLIIGWKGTPIHSLSIWK 587
                 ******************************************************8899*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.035191566IPR005202Transcription factor GRAS
PfamPF035142.4E-90217587IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MANVSISNEN FSDFQDDQFH LNGYEGGVVV NGIEDPWFEH IDYVDIDSFY SMFGPNNEED  60
TSDLQVRINL LEDQQQSILD WMQNHFPTNT VMPLQPVQIQ STVEIPGNDD LQTQVPERGK  120
DSNEKPNPFS LASLELLKNY GRLSKNSSEE NLSTNALNFE ACLGNRHRLS MEEILRVAAE  180
RYIQYSTRKL DGLSRFIHPY GSALSGLCME ETRDVELVHH LLAAVEEVNN QQFHLASKLI  240
SRCMWVASDS GTPVQRLSFY FAKALEERIH RSTGRYTCTD EDRHLKYIKT KSLGTNATSL  300
TCHQLIPFNQ VMQFAAVQTI VENVKSAKKI HLIDFNIRSG IQWIVLIQAL AEKGDSPIEL  360
LKITAVGSTE KENYEVTGNT LHSFAKSLGL PFSFDIVFVS DMKDFKKESI NIETDETVAV  420
YLNFILRTMI PRPDCLDNLM KVVRSIRPTV IVVGEVEANH NSPSFLNRFI ETLFFYSAFF  480
DCFEDCMDRD SPCRTTIEEV YFGEGVRNIV AAEGEDRFTR NVKLEVWRAF FERFGMMEEE  540
LSESSWYQAD LILKQFAQSS SCDLHKDGKG LIIGWKGTPI HSLSIWKFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-4523558721375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016540164.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A1U8E8L30.0A0A1U8E8L3_CAPAN; Uncharacterized protein
TrEMBLA0A2G3AK700.0A0A2G3AK70_CAPAN; DELLA protein RGL1-like
STRINGPGSC0003DMT4000233450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.13e-58RGA-like 1