PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g22800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family SBP
Protein Properties Length: 984aa    MW: 109192 Da    PI: 6.0111
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g22800genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.99e-41126203178
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 +Cqv++C +dls+ak+yhrrhkvCe+hska+ +lv +++qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+q+
  CA01g22800 126 VCQVDDCGTDLSKAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFHALQEFDEGKRSCRRRLAGHNKRRRKTQS 203
                 6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.5E-33122188IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.086124201IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.85E-38125206IPR004333Transcription factor, SBP-box
PfamPF031107.6E-30127200IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.35E-7753867IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.2E-5756870IPR020683Ankyrin repeat-containing domain
CDDcd002041.09E-6757867No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 984 aa     Download sequence    Send to blast
MGGPDLRGLG KRSLEWDLTD WKWDGDLFIA TPLHQNAPNY QSRQFFPVET GNLASSNSSS  60
SCSEEVNHGM EQQRRELEKR RRVIVVEEDD SGPLSQLPHP PXLGGNWDGA AGKRTKLVAP  120
AGSRAVCQVD DCGTDLSKAK DYHRRHKVCE MHSKASRALV GNVMQRFCQQ CSRFHALQEF  180
DEGKRSCRRR LAGHNKRRRK TQSESVANNN SVNEGQASGY SLMSLLKILS NMHSNGTNPT  240
EDQNLLSHLL RSLASQGTTN GDKSLSGLLQ ESSNLLNNRS ILRNPEVASL ISNGSQAPPR  300
AKEHQFTNSA TEMPQKRLDV HDVRLEDART ASSQSPGILF PIQSNSQAYT PGRESTTGRS  360
KLMDFDLNDA YVDSDDCGED LVRSPVPECP SWLQQDSHQS SPPQTSGNSD SASAQSPSSS  420
SGDNQNRTDR IVFKLFGKDP SDFPFVVRAQ ILDWLSHSPT EIESYIRPGC IVLTIYLRLP  480
ESAWEELSYN LSSSLSRLLD VPGGDSFWTR GWIYIRVQNQ IAFVCDGQVL LDMSLPYVSN  540
DDSTLLSVRP IAVPVSGRVQ FLVKGYNLTK PSTRLLCALD GSYLVPEANN EVEEHGDVVG  600
KDDKIQSLNF TYSVSAVAGR GFIEVEDHGV NNSFFPFIIA EEDVCSEIRM LESDLELSSS  660
DYVNGQTSNM EARNQAMDFI HELGWLLHRN NLKARLDHFG PNAVLYPLKR FKWLVDFSVD  720
HDWCAVVKKL LNILLDGTVG AGDNSFLKFA LSELGLLHRA VRRNSRPLVE LLLTYTPESV  780
ADELCSEYQS LVGIDGEFLF RPDCVGPAGL TPLHVAACID GYEDVLDALT DDPGKVAIEA  840
WKNTRDGAGF TPEDYARLRG HYSYIHLVQR KISKKATSGH IVVDIPSVPA VVESNNQKDE  900
VYTTTSLEIT MTERTPIARP CGLCDRKLAY GSRGRSLLYR PAMFSMVAMA AVCVCVALLF  960
RGSPEVLYIF RPFRWEMVDF GTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-311262001084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17882KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269|PubMed:16554053}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00633PBMTransfer from PK06791.1Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016539898.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9S7P50.0SPL12_ARATH; Squamosa promoter-binding-like protein 12
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A1U8DXZ30.0A0A1U8DXZ3_CAPAN; squamosa promoter-binding-like protein 1
STRINGPGSC0003DMT4000133170.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jung S, et al.
    Synteny conservation between the Prunus genome and both the present and ancestral Arabidopsis genomes.
    BMC Genomics, 2006. 7: p. 81
    [PMID:16615871]
  2. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  3. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]