PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g19610
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family SRS
Protein Properties Length: 224aa    MW: 24818.5 Da    PI: 8.3979
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g19610genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702189.11.6e-58131543154
      DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskkele 101
                 s +++CqdCGnqakkdC+++RCRtCCksrg++C+thvkstWvp++ rr r++ ++++ +++++   +a ++ kr       s+ s++ +  ++     e
  CA01g19610  13 SSSSRCQDCGNQAKKDCTYMRCRTCCKSRGYHCETHVKSTWVPVSTRRPRHHLHHSTIQQQQQ-LIQAGPNPKRYR-----SNESHQVIGGGD----QE 101
                 56789********************************************97777766555443.433333333332.....233333344443....35 PP

      DUF702 102 tsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                 + ++P evss+avfrc+rvss+d++ +++aYqt+v+i+Gh+fkGiLydqG+++
  CA01g19610 102 AGDFPVEVSSAAVFRCIRVSSIDNAVDQYAYQTSVKIAGHIFKGILYDQGPDD 154
                 788************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.3E-6015153IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016232.4E-271859IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.0E-26105152IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MMRRSEEEGI SSSSSSRCQD CGNQAKKDCT YMRCRTCCKS RGYHCETHVK STWVPVSTRR  60
PRHHLHHSTI QQQQQLIQAG PNPKRYRSNE SHQVIGGGDQ EAGDFPVEVS SAAVFRCIRV  120
SSIDNAVDQY AYQTSVKIAG HIFKGILYDQ GPDDHESPRY SNINTNNMAG ESSSTGFQLQ  180
QSPNLPITTA TTSPHPPAST YPNLLFSALN MPGTQFFQYP KSS*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016582417.11e-169PREDICTED: protein SHI RELATED SEQUENCE 3-like
SwissprotQ9SD404e-52SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLK4B3M74e-93K4B3M7_SOLLC; Uncharacterized protein
STRINGSolyc01g110140.2.11e-92(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41562445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.16e-47Lateral root primordium (LRP) protein-related