PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g19340
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 427aa    MW: 47627.1 Da    PI: 6.0532
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g19340genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like40.94.7e-131862162555
     G2-like  25 ekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 ++A+Pk+i+e+m+ +gLt+ehv+ HLQkYRl
  CA01g19340 186 KEAVPKKIVEIMDEPGLTREHVARHLQKYRL 216
                 68****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.41E-713126IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23009.3E-1017154No hitNo description
Gene3DG3DSA:1.10.10.604.5E-12179220IPR009057Homeodomain-like
SuperFamilySSF466891.38E-5180220IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-10183216IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MDIQGVGANS SDMGTKNICI VLVLDDFTIH HIVSDMLDNQ TYQEYLQSCF VEKTMDALNV  60
IWERKSIFNL VLTNIHRLHT NGVDILQIIK NKLNLPTILM SPGDEKYENQ VQDCSVAAYV  120
VSFSDTNEMN KFWQKVLEKE KGRKAAEENN DDENATRMPQ NVTADTSRDN TSSADTDTAI  180
HARDTKEAVP KKIVEIMDEP GLTREHVARH LQKYRLCLKR AQKSSSASIY DEILSNDAKE  240
KFSQVQPYLS SLNFSASRGY SHSMQQPFQT YFQQGTGGMN GLLDFANSRE ADHNALIGQH  300
SAFVPRIAHG SNFRVYGDKR KNMLFSIQSG NANQPTNSNS GLEFIGFRLS TDGKSVNFGQ  360
KGLSCALIPN NAYSGLSSSL SEDYIHKQQS SPPFLETPIE NTLIQSSSVQ PENLTFNHPC  420
NSTSEQ*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-156HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015168044.10.0PREDICTED: two-component response regulator ARR14-like
RefseqXP_016480490.10.0PREDICTED: two-component response regulator ARR12-like
TrEMBLA0A2G3DE170.0A0A2G3DE17_CAPCH; Uncharacterized protein
STRINGPGSC0003DMT4000890080.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA36591620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-18response regulator 2