PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g08210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 280aa    MW: 31493.3 Da    PI: 7.0777
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g08210genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.8e-332377155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  CA01g08210 23 KPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 77
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.4552080IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.4E-322078IPR009057Homeodomain-like
SuperFamilySSF466893.05E-162380IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-242378IPR006447Myb domain, plants
PfamPF002498.3E-92576IPR001005SANT/Myb domain
PfamPF143792.0E-20123169IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDRMYNGGGD GYENGVVMTR DPKPRLRWTA DLHDRFVDAV TKLGGPDKAT PKSVLRLMGL  60
KGLTLYHLKS HLQKYRLGQQ AKKQNAAEQN RENIAESFGQ FSLHSSGPSI TSSSMNGMQG  120
EAPISEQLRC QFEVQKRLQK QLEVQQKLQM RIEAQGKYLQ AILDKAQKSL SIDMTSPRAV  180
DETKAQLTDF NTALSNLMDY MHGVNRDETA AGKRTQDDSN DDQQTSTYLM KEEQNNNMNI  240
KVEETSVSFD LNSRSSYDFI VMNSDSLEAK PFPNGRLEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-192376154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-192376154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-192376154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-192376154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY3031701e-127AY303170.1 Solanum bulbocastanum chromosome 8 clone UW3A14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016571647.10.0PREDICTED: myb family transcription factor APL isoform X2
SwissprotC0SVS45e-83PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A1U8GK550.0A0A1U8GK55_CAPAN; myb family transcription factor APL isoform X2
STRINGSolyc08g076010.2.11e-163(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44162139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.16e-60G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]