PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g02240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family TALE
Protein Properties Length: 630aa    MW: 70609.5 Da    PI: 6.9533
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g02240genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.66.7e-063834221954
                 HHH..SSS--HHHHHHHHHHCTS-HHH..HHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterq..VkvWFqNrRak 54 
                 Fe   ++yps  ++  LA+++gL+ +q  V++WF N R +
  CA01g02240 383 FEHflHPYPSDVDKHILARQTGLSRSQafVSNWFINARVR 422
                 554459******************99988999******88 PP

2BELL117.85.1e-38242311372
        BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  elqk+k+kLl++leeVd+rYk+y++q+++v+ssFeavag g+a++Y slA++a+SrhFrcL+d i+ qi
  CA01g02240 242 IELQKRKTKLLQMLEEVDRRYKHYCDQMKAVVSSFEAVAGNGAATVYSSLASRAMSRHFRCLRDGIVAQI 311
                 69******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.1E-52169309IPR006563POX domain
PfamPF075261.3E-46176307IPR006563POX domain
PROSITE profilePS500719.41361426IPR001356Homeobox domain
SMARTSM003896.0E-5364430IPR001356Homeobox domain
CDDcd000863.17E-10364427No hitNo description
SuperFamilySSF466898.55E-14365432IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-25367432IPR009057Homeodomain-like
PfamPF059206.8E-16381422IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MVTNTGYWFD GHSSNSSNPN MVNHQMQSFE TNPEMYNLTS GMEMIGFLPN TNDNPHPHML  60
WKGNSGVGGG PSLSKNDTSS SEQFYQHGNN MLVATEHWQH DDPSLRCVFP CEGNERPSQG  120
LSLSLCSSNP SSIGLQSFEL RHHHQQEIGL IHDGFLGKSA NLQPQNNHQG YFHHQIRDSK  180
YLGPAQALLS EFCSLGIKQN DDHSSSSKVQ KQQQQQKPHQ WQDHESASTS KKQLLLQSLD  240
IIELQKRKTK LLQMLEEVDR RYKHYCDQMK AVVSSFEAVA GNGAATVYSS LASRAMSRHF  300
RCLRDGIVAQ IKATKKAMGE KDSSSSTLIP GSTRGETPRL RVLDQTLRQQ KAFQQMNMME  360
THPWRPQRGL PERSVSVLRA WLFEHFLHPY PSDVDKHILA RQTGLSRSQA FVSNWFINAR  420
VRLWKPMVEE MYLEETKEEE ENLGSPNGSK ALDDMNVMNQ NNPHQSHIDQ EQKPNLVSID  480
SECISSIINH PHEKNDHTNK TSLDQHDHHH QVQTYGVRGG GQPFGAIELD FSTNMAYGTG  540
GDHGGMSNKN HLGVGGGVSL TLGLQQHGGS GSMGLSTFSS QPPHHHQSSL FYMNPRDDQV  600
QYSSLLDSEN QNLPYRNLMG AQLLHDLAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A9e-14370430563Homeobox protein Meis2
3k2a_B9e-14370430563Homeobox protein Meis2
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4067000.0AF406700.1 Solanum tuberosum BEL1-related homeotic protein 14 (Bel14) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016566562.10.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-135BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLA0A0V0INA80.0A0A0V0INA8_SOLCH; Putative homeobox protein BEL1-like
STRINGPGSC0003DMT4000321220.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53001317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-107TALE family protein