PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA01g00820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family ARF
Protein Properties Length: 648aa    MW: 72308.1 Da    PI: 7.1217
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA01g00820genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3733.5e-2372172198
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                 f+kvlt sd++++g +++ +k+a+e+       +++++  ++l+ +d+++ +W +k+i+r++++r++lt+GW+ Fv+a++L +gD++vF   + +++el
  CA01g00820  72 FCKVLTASDTSTHGGFSVLRKHANEClppldmnQQIPT--QELIAKDLHNVEWHFKHIFRGQPRRHLLTTGWSTFVSAKRLVAGDSFVFL--RGENGEL 166
                 99****************************97544444..48************************************************..4499999 PP

                 EEEEE- CS
          B3  93 vvkvfr 98 
                 +v+v r
  CA01g00820 167 RVGVKR 172
                 999866 PP

2Auxin_resp95.67.4e-32198277183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha++t+++F v+Y+Pr+  ++F v v+k+++a+k+ +svG+Rfkm+fe+e+ +err++Gt+vgv dl++ +W++SkWrsLk
  CA01g00820 198 ASHAVTTHTMFVVYYKPRT--TQFLVGVNKYLEAVKRGYSVGTRFKMQFESEENPERRYMGTIVGVDDLSS-EWKHSKWRSLK 277
                 789***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019362.22E-3964201IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.3E-4065186IPR015300DNA-binding pseudobarrel domain
CDDcd100174.44E-2170172No hitNo description
SMARTSM010196.4E-2172174IPR003340B3 DNA binding domain
PROSITE profilePS5086311.51972174IPR003340B3 DNA binding domain
PfamPF023624.1E-2172172IPR003340B3 DNA binding domain
PfamPF065072.0E-29198277IPR010525Auxin response factor
PfamPF023091.2E-6551589IPR033389AUX/IAA domain
PROSITE profilePS5174522.163553647IPR000270PB1 domain
SuperFamilySSF542772.49E-10556629No hitNo description
PfamPF023096.2E-5595638IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MNQEMNLRVP SSFSLKPNIL CRVIHIHFLA EEDTDELYAQ ITLMPVAPDE APEPNRPEPP  60
PPVPARPKVH SFCKVLTASD TSTHGGFSVL RKHANECLPP LDMNQQIPTQ ELIAKDLHNV  120
EWHFKHIFRG QPRRHLLTTG WSTFVSAKRL VAGDSFVFLR GENGELRVGV KRLGRQQSSM  180
PSSVMSRQSM HLGVLATASH AVTTHTMFVV YYKPRTTQFL VGVNKYLEAV KRGYSVGTRF  240
KMQFESEENP ERRYMGTIVG VDDLSSEWKH SKWRSLKVQW DEPASILRPD RVSPWEIEPY  300
VSPFPDPLIH SIAGKNKRHR LHTDIKISGP NENSQQHCLF SCIEPSSSIV SAIWNPSIDS  360
PQFNTSGINN STSTLASHAE GGWPLAHLNA LSSMLVDEAE DSKSASALSG FPSVLTPQYG  420
LGTNQPIVGS ADERKCDNVT TCRLFGIDLK SSSIGTNEAP LQQPATISCG SAEKAPPNTV  480
PAGDSDQNSD LSIDLKDQIS HLQVLLKEVQ SKPSCSTRTR TKVLNQKPEL HSYKLNIASK  540
AIIKTLNMFS HVESLEKVQM QGVAVGRAVD LTKLKGYDEL TKELEEMFEI QGELHSRNKW  600
DIVFTDDEGD MMLMADYPWQ DFCNVVRRIF ICSTQDMKKL TLSRADS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-138129956354Auxin response factor 1
4ldw_A1e-138129956354Auxin response factor 1
4ldw_B1e-138129956354Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016565841.10.0PREDICTED: auxin response factor 9-like
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A2G3ADF60.0A0A2G3ADF6_CAPAN; Auxin response factor
TrEMBLA0A2G3DAW00.0A0A2G3DAW0_CAPCH; Auxin response factor
STRINGPGSC0003DMT4000319650.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9