PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g91730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 412aa    MW: 44902.9 Da    PI: 5.433
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g91730genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.63.8e-30229280152
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQk 52 
                 kpr+rWtpeLHe Fveav++LGGsekAtPk +l++m+v+gLt++hvkSHLQ 
  CA00g91730 229 KPRMRWTPELHEVFVEAVSKLGGSEKATPKGVLKTMNVEGLTIYHVKSHLQN 280
                 79*************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.247226286IPR017930Myb domain
SuperFamilySSF466895.2E-16227286IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-27228282IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-22229281IPR006447Myb domain, plants
PfamPF002491.5E-8231280IPR001005SANT/Myb domain
PfamPF143793.0E-22313358IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MNMRRALCVQ RSSEAQHSNM GVSGATSTSS NLIPSQAIPS ASKSRTVGHL LSLTSGPHKD  60
FNFCSTSAQE SRQHNYPFIS SEASAATCRS SLSSIHSTSF DNCPIGNDSN SSGKDAYHDL  120
INFPTNDPVQ NGQVESLAVV MPSDNQAKRS DWQEWADQLI NEDDDGGLGS SWNDILVDIS  180
PPEIKFLETS EVLACESHIL PSPAAVVAAA SSGQSYPVGS PSSTTALTKP RMRWTPELHE  240
VFVEAVSKLG GSEKATPKGV LKTMNVEGLT IYHVKSHLQN CQIRYKPEPS EGTSEKKSTS  300
VIEMPSLDLK TTMGITEALR LQMEAQKQLH EQLEIQRKLQ LRIEEQGKYL EMMFERTKDI  360
GKDFKVSSSI TDEHPSPSTE PKHSPPNDKS EALEKDPVSL NDRSITGQES S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-24229286260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-24229286260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-24229286260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-24229286260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-24229286260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-24229286260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-24229286260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-24229286260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016573871.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_016573872.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A2G2XUP10.0A0A2G2XUP1_CAPAN; Protein PHR1-LIKE 1
STRINGPGSC0003DMT4000603240.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45822139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.12e-76phosphate starvation response 1