PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g86330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 176aa    MW: 19115 Da    PI: 9.2569
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g86330genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26052.21.7e-166702791
      DUF260 27 pkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91
                 +++ +++k++G++ +l+l+++ p++ r+++++sl+yeA+ r+ +P+yG++g+++++++ql+  +
  CA00g86330  6 XNATLFLAKFYGRAGLLNLINSGPDHLRPAIFRSLLYEACGRIVNPIYGSTGLLTSGNWQLSADA 70
                5778999*****************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.636180IPR004883Lateral organ boundaries, LOB
PfamPF031955.8E-12769IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MVAGSXNATL FLAKFYGRAG LLNLINSGPD HLRPAIFRSL LYEACGRIVN PIYGSTGLLT  60
SGNWQLSADA TSPSLKACDI RHVSKENNSG SELHKVRTRT RFKRVAGKPE LKKQSPEVDD  120
AARVMWSWCH KEDDVIGVGS PSRNSGLSQQ RTEEPSREGE SXXXXXXXXX AGEAG*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016563124.11e-107PREDICTED: LOB domain-containing protein 41-like
SwissprotQ9M8864e-40LBD41_ARATH; LOB domain-containing protein 41
TrEMBLA0A0V0HWG79e-92A0A0V0HWG7_SOLCH; Putative LOB domain protein 40-like
TrEMBLK7VSW91e-91K7VSW9_SOLTU; LOB domain protein 40
STRINGPGSC0003DMT4000146306e-90(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8862494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02550.12e-41LOB domain-containing protein 41