PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g75310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family LBD
Protein Properties Length: 172aa    MW: 19372.6 Da    PI: 6.8959
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g75310genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.5e-4212110199
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrrkC ++Cv+apyfp e+p kf  vhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el+++++
  CA00g75310  12 PCAACKFLRRKCLPSCVFAPYFPPEEPIKFTTVHKVFGASNVSKLLNEIQPHQREDAVNSLAYEAEARLKDPVYGCVGAISVLQRQVIRLQKELDATNA 110
                 7*********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.91811112IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-4212109IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MSSTSSYYST PPCAACKFLR RKCLPSCVFA PYFPPEEPIK FTTVHKVFGA SNVSKLLNEI  60
QPHQREDAVN SLAYEAEARL KDPVYGCVGA ISVLQRQVIR LQKELDATNA DLMRYTNYEQ  120
ANNNQIMENH QERSNFQYGR RMVPSYYSSA RNNDISGDHN NISTDNCDGD S*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016559091.11e-127PREDICTED: LOB domain-containing protein 25
SwissprotQ8L8Q32e-65LBD25_ARATH; LOB domain-containing protein 25
TrEMBLM1A9H41e-102M1A9H4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000178051e-101(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.12e-64LOB domain-containing protein 25