PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g74540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family SBP
Protein Properties Length: 233aa    MW: 25582.9 Da    PI: 9.8513
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g74540genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.39.4e-43150225277
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 Cqv+gC +dls +k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk++
  CA00g74540 150 CQVQGCGKDLSPCKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPH 225
                 **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-34144211IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.701147224IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.16E-39148228IPR004333Transcription factor, SBP-box
PfamPF031103.2E-32150223IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MESWSYFSGG KGFVSDESVS GKNGVMGWEL KTPSSYGSTV ICSSQHGSDN PIFQELGSPN  60
LMRKPMFSDQ MRGVGNIFGS VAGAFSGEDK SSSISRDTSL IDLKLGRFPD HVDANIFKSP  120
KSMPSFTTAE SIVPAKRMRA GGVNSHKPFC QVQGCGKDLS PCKDYHKRHK VCEVHSKTAK  180
VIVNGIEQRF CQQCSRFHLL AEFDDGKRSC RKRLAGHNER RRKPHTGTHS GY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-311492231084squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0134571e-118BT013457.1 Lycopersicon esculentum clone 132113R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016545418.11e-168PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_016545419.11e-168PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A2G3CYZ61e-167A0A2G3CYZ6_CAPCH; Squamosa promoter-binding-like protein 3
STRINGSolyc03g114850.2.11e-121(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-48SBP family protein