PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g64660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family ARF
Protein Properties Length: 696aa    MW: 77726.6 Da    PI: 6.7088
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g64660genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.91.9e-23111211198
                 EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                 f+k+lt sd++++g +++ +k+a+e+       +   + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF +  + ++el
  CA00g64660 111 FCKILTASDTSTHGGFSVLRKHANEClpqldmtQ--ATPTQDLVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLR--DGNGEL 205
                 99**************************999543..445568************************************************5..468888 PP

                 EEEEE- CS
          B3  93 vvkvfr 98 
                 +v+v+r
  CA00g64660 206 RVGVRR 211
                 ***998 PP

2Auxin_resp101.61e-33237316183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha++t++ F v+Y+Pr+  s+F+v ++k+++a+++ +svGmRf+m+fe+eds+err++Gt+vg+ d+++ +W++SkWrsLk
  CA00g64660 237 ASHAITTNTRFVVYYKPRT--SQFIVGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERRFTGTIVGTGDISS-QWSESKWRSLK 316
                 789***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.26E-39102240IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.9E-40105226IPR015300DNA-binding pseudobarrel domain
CDDcd100174.03E-20109211No hitNo description
SMARTSM010196.7E-22111213IPR003340B3 DNA binding domain
PfamPF023622.3E-21111211IPR003340B3 DNA binding domain
PROSITE profilePS5086312.351111213IPR003340B3 DNA binding domain
PfamPF065071.3E-31237316IPR010525Auxin response factor
PfamPF023097.5E-6575618IPR033389AUX/IAA domain
SuperFamilySSF542771.96E-12576658No hitNo description
PROSITE profilePS5174526.265582674IPR000270PB1 domain
PfamPF023091.2E-6628672IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MGSEDLYTEL WKACAGPLVD VPRNGERVYY FPQGHIEQLE ASTNQAVNQQ IPQFNLSSKI  60
LCRVVHIQLL AEADTDEVYA QITLHPEAEQ EEPSKPDPCL PDLPKRTVHS FCKILTASDT  120
STHGGFSVLR KHANECLPQL DMTQATPTQD LVAKDLHGYE WRFKHIFRGQ PRRHLLTTGW  180
STFVTSKRLV AGDAFVFLRD GNGELRVGVR RLARQQSPMP QSVISSQSMH LGVLATASHA  240
ITTNTRFVVY YKPRTSQFIV GLNKYLEAVS HGFSVGMRFR MRFEGEDSPE RRFTGTIVGT  300
GDISSQWSES KWRSLKIHWD EPASMVRPDR VSPWEIEPFV APTSGDVAQP GIKSKRPRPL  360
DLPRTAQSLK SSNNWFVVEI AVASASSPFW YPGSGPTLEV SHLGSITEVQ SHDNQLFWSS  420
KQNSSLSNGV SNTSCRTHIS GAWQHSILEN GSLNLLRDSI EDNKQLITRS ALLDYGSPMS  480
SRASNGLLHD LVDRGNKREI SSSCRLFGID LRNSNNTPTK AKEILGPNVA SSSADQAPMV  540
PDKSDVDKDQ CVEHLNHSDE KEQVPLEALP KDTHKQGLTS SRTRTKVQMQ GVRVGRAVDL  600
TALSGYDNLI SELEKIFDIK GELCPRNKWE VVYTDDEDDM MLVGDDPWPE FCNMVRRIFI  660
YSSEEVKKMT PRCKLPILSV EGEATMPSVD SEVKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-168333916355Auxin response factor 1
4ldw_A1e-168333916355Auxin response factor 1
4ldw_B1e-168333916355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1354358KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2331200.0AC233120.6 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-101i8 map 1, complete sequence.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016538207.10.0PREDICTED: auxin response factor 9-like isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A2G2YYA20.0A0A2G2YYA2_CAPAN; Auxin response factor
STRINGPGSC0003DMT4000003450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9