PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g62840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family G2-like
Protein Properties Length: 388aa    MW: 42934.6 Da    PI: 4.9602
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g62840genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like971.4e-30246296151
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                 k+r+rWtpeLHe+Fveav++LGGse+AtPk +l+lmkv+gLt++hvkSHLQ
  CA00g62840 246 KQRMRWTPELHEAFVEAVNKLGGSERATPKGVLKLMKVEGLTIYHVKSHLQ 296
                 79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.593243300IPR017930Myb domain
SuperFamilySSF466891.43E-15244298IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-27245296IPR009057Homeodomain-like
TIGRFAMsTIGR015579.4E-23246297IPR006447Myb domain, plants
PfamPF002497.8E-9248296IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MEARPAVSVQ NVVASQLSNC GASGTLSSSL CMFPTALGEK YPKFPDLQQA SMEKELKQHP  60
GTVASSLPSN SGAVGHMFSS SSGFSADLHF SSVSTQEKHS GPTSFISQST YSETSITFPH  120
SGVLQSTASS QYLNENHEPW CIDPLPNFLD YSVDTPVQNS QVACSDKQSD WQEWADLVIN  180
DEDALTSNWN DIMADTSIAD LELKEEKQPL NFQMQQVQES EQIPAVPVEN LAIAPASSPA  240
SSAATKQRMR WTPELHEAFV EAVNKLGGSE RATPKGVLKL MKVEGLTIYH VKSHLQVCSI  300
SCPSSWSLLE MDLLYFLIDG CEPFFWKCRN IEQLDINQKH QRVCRNFSFF CACQCISFFI  360
HFTFLFSQAI LKKCLVLVLD FFVVVKL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-28246296252Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-28246296252Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-28246296151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-28246296151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-28246296151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-28246296151Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-28246296252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-28246296252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-28246296252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-28246296252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-28246296252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-28246296252Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016565591.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X2
TrEMBLA0A1U8G2J00.0A0A1U8G2J0_CAPAN; protein PHR1-LIKE 1-like isoform X2
STRINGXP_009781296.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.12e-48phosphate starvation response 1