PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g46270
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NAC
Protein Properties Length: 291aa    MW: 33375.6 Da    PI: 6.2403
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g46270genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.18.8e-50101381129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrF P+deelv++yL kk++++++    ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat+sgyWkatgkd++v++  +++
  CA00g46270  10 LPPGFRFYPSDEELVCHYLFKKITNEEVLK-GTLVEIDLHTCEPWQLPEVAKLNSSEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRTVVDPkTRT 107
                 79************************9655.78***************87788899**************************************85566 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                  vg++ktLvfy +rap+g kt W+mhe+rle
  CA00g46270 108 IVGMRKTLVFYMNRAPNGIKTGWIMHEFRLE 138
                 7***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.1E-608156IPR003441NAC domain
PROSITE profilePS5100557.44210156IPR003441NAC domain
PfamPF023651.5E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLFK KITNEEVLKG TLVEIDLHTC EPWQLPEVAK  60
LNSSEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRTV VDPKTRTIVG MRKTLVFYMN  120
RAPNGIKTGW IMHEFRLENP HIPPKEDWVL CRVFHKTKAE NNSNNNNNNV LSPQNMYEVG  180
VNSPHNMDQS HALPYVGPRP MAATAFSQRQ VNNQSQKLFD LLEPNHNPSS YLQLMSQEMK  240
APPSNDQMVE DDEYGFLLDM NFENPNIQDG GVHSSIGDMK FDDENSLVFI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-48915616165NO APICAL MERISTEM PROTEIN
1ut4_B9e-48915616165NO APICAL MERISTEM PROTEIN
1ut7_A9e-48915616165NO APICAL MERISTEM PROTEIN
1ut7_B9e-48915616165NO APICAL MERISTEM PROTEIN
3swm_A1e-47915619168NAC domain-containing protein 19
3swm_B1e-47915619168NAC domain-containing protein 19
3swm_C1e-47915619168NAC domain-containing protein 19
3swm_D1e-47915619168NAC domain-containing protein 19
3swp_A1e-47915619168NAC domain-containing protein 19
3swp_B1e-47915619168NAC domain-containing protein 19
3swp_C1e-47915619168NAC domain-containing protein 19
3swp_D1e-47915619168NAC domain-containing protein 19
4dul_A9e-48915616165NAC domain-containing protein 19
4dul_B9e-48915616165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754481e-97HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755211e-97HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016565477.10.0PREDICTED: NAC domain-containing protein 21/22-like
TrEMBLA0A2G2ZXH60.0A0A2G2ZXH6_CAPAN; Protein CUP-SHAPED COTYLEDON 3
STRINGXP_009607926.11e-172(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.18e-93NAC domain containing protein 74