PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA00g32460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family SBP
Protein Properties Length: 219aa    MW: 24904.2 Da    PI: 6.9918
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA00g32460genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP71.61.4e-22170217249
                 -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
         SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                 Cq+egC+adl++ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsr 
  CA00g32460 170 CQAEGCNADLTHAKHYHRRHKVCEFHSKAATVVAAGLTQRFCQQCSRL 217
                 **********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-24164216IPR004333Transcription factor, SBP-box
PROSITE profilePS5114120.256167218IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-21168217IPR004333Transcription factor, SBP-box
PfamPF031102.1E-16170217IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MLDYEWENQS TFIFPNDQTN QENEQNNNQF LDPHANFSPM TNYQHQQQQQ QQLQVQNSQF  60
PQYQVNPNNN QFNSLYDPRA YGVTYTNNTH ETSLLSLQPT GSSTGFMLMP KTEPQFGGGI  120
HDFSSTTTTR IGLNLGGRTY FASSSDDDFV NRLYRRTRTV EAGSLNTPKC QAEGCNADLT  180
HAKHYHRRHK VCEFHSKAAT VVAAGLTQRF CQQCSRLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A1e-17170217653squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. Binds specifically to the 5'-GTAC-3' core sequence. Involved in development and floral organogenesis. Required for ovule differentiation, pollen production, filament elongation, seed formation and siliques elongation. Also seems to play a role in the formation of trichomes on sepals. May positively modulate gibberellin (GA) signaling in flower. {ECO:0000269|PubMed:12671094, ECO:0000269|PubMed:16095614, ECO:0000269|PubMed:17093870}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016544498.11e-137PREDICTED: squamosa promoter-binding-like protein 8
RefseqXP_016544504.11e-137PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL33e-55SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A2G3AME01e-161A0A2G3AME0_CAPAN; Squamosa promoter-binding-like protein 8
TrEMBLA0A2G3DJ701e-161A0A2G3DJ70_CAPCH; Squamosa promoter-binding-like protein 10
STRINGSolyc01g090730.2.11e-110(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48462341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.21e-51squamosa promoter binding protein-like 8
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Xing S, et al.
    SPL8 Acts Together with the Brassinosteroid-Signaling Component BIM1 in Controlling Arabidopsis thaliana Male Fertility.
    Plants (Basel), 2013. 2(3): p. 416-28
    [PMID:27137384]