PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv9_221980_hehi.t2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family M-type_MADS
Protein Properties Length: 114aa    MW: 13132.1 Da    PI: 9.6148
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv9_221980_hehi.t2genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.61.6e-28959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        +ri+n + rqvtf+kRr+g++KKA+ELS+LCdaev +iifss+gk+ye++s
  Bv9_221980_hehi.t2  9 ERIDNVTSRQVTFTKRRKGLFKKAKELSILCDAEVGIIIFSSSGKVYEFAS 59
                        69***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.3E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.81161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-32287IPR002100Transcription factor, MADS-box
CDDcd002651.34E-39274No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-28323IPR002100Transcription factor, MADS-box
PfamPF003198.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MGRGKISIER IDNVTSRQVT FTKRRKGLFK KAKELSILCD AEVGIIIFSS SGKVYEFASH  60
CMQSLLQRYY KANEENQVLN PTSEAQLWKV EAESLRQQLE DLRMNSSQLN TCRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-21177177MEF2C
5f28_B2e-21177177MEF2C
5f28_C2e-21177177MEF2C
5f28_D2e-21177177MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010691448.12e-74PREDICTED: MADS-box transcription factor 23
SwissprotQ6EP494e-44MAD27_ORYSJ; MADS-box transcription factor 27
SwissprotQ6VAM42e-44MAD23_ORYSJ; MADS-box transcription factor 23
SwissprotQ9SZJ64e-44AGL21_ARATH; Agamous-like MADS-box protein AGL21
TrEMBLA0A0K9RUZ72e-68A0A0K9RUZ7_SPIOL; Uncharacterized protein
STRINGXP_010691448.18e-74(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.12e-46AGAMOUS-like 21
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Puig J, et al.
    Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice.
    Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70
    [PMID:23466806]
  3. Yu C, et al.
    The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice.
    PLoS ONE, 2014. 9(8): p. e105597
    [PMID:25140876]
  4. Wang H, et al.
    A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway.
    Plant Physiol., 2016. 170(4): p. 2365-77
    [PMID:26858364]
  5. Yu LH, et al.
    Arabidopsis MADS-Box Transcription Factor AGL21 Acts as Environmental Surveillance of Seed Germination by Regulating ABI5 Expression.
    Mol Plant, 2017. 10(6): p. 834-845
    [PMID:28438576]
  6. Qu Y, et al.
    Peroxisomal CuAO╬ and its product H2O2 regulate the distribution of auxin and IBA-dependent lateral root development in Arabidopsis.
    J. Exp. Bot., 2017. 68(17): p. 4851-4867
    [PMID:28992128]
  7. Sun CH, et al.
    Chrysanthemum MADS-box transcription factor CmANR1 modulates lateral root development via homo-/heterodimerization to influence auxin accumulation in Arabidopsis.
    Plant Sci., 2018. 266: p. 27-36
    [PMID:29241564]