PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv9_215500_qmrs.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family M-type_MADS
Protein Properties Length: 222aa    MW: 25295.7 Da    PI: 9.1662
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv9_215500_qmrs.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.99.9e-221861245
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        r e +snrqvtfskRr g++KKA+EL++LC+ae+ +i+fs+  k
  Bv9_215500_qmrs.t1 18 RMEKDSNRQVTFSKRRCGLFKKASELCTLCGAEATIIVFSPGRK 61
                        7899************************************9766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.815969IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-29968IPR002100Transcription factor, MADS-box
CDDcd002658.88E-311078No hitNo description
SuperFamilySSF554553.01E-261090IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-181131IPR002100Transcription factor, MADS-box
PfamPF003192.6E-231865IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-183146IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-184667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009960Biological Processendosperm development
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MSTSAKKNRG RQKVKMARME KDSNRQVTFS KRRCGLFKKA SELCTLCGAE ATIIVFSPGR  60
KAFSFGHPSV ETIINRFLIS SFSSTSDSES EQALAEADQR SASVRDLSLE LTLISNQMEI  120
EKKRSEEINE IKKAKERHNW WDQQIEKLTF QHLVHLKTSL EELKKNVVQH GRNLIMLEAS  180
NDATNNTHQF PYMGINYPML GCYDGAFFNP NGAGFIQYGQ DY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010690727.21e-168PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A0K9RWQ07e-75A0A0K9RWQ0_SPIOL; Uncharacterized protein
STRINGXP_010690727.11e-156(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-52AGAMOUS-like 62