PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv9_215490_dcet.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family M-type_MADS
Protein Properties Length: 392aa    MW: 42714 Da    PI: 5.43
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv9_215490_dcet.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.93.6e-201861245
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                        r e +snr vtfskRr+g++KK +EL++LC+ae+avi+fs+  k
  Bv9_215490_dcet.t1 18 RMEKESNRLVTFSKRRAGLFKKTSELCTLCGAEAAVIVFSPGRK 61
                        57899***********************************9766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-27968IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.105969IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.53E-231078IPR002100Transcription factor, MADS-box
CDDcd002657.11E-301077No hitNo description
PRINTSPR004043.3E-151131IPR002100Transcription factor, MADS-box
PfamPF003192.7E-221865IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-153146IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-154667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MANIERKNKG RQRVAMVRME KESNRLVTFS KRRAGLFKKT SELCTLCGAE AAVIVFSPGR  60
KAFSFGHPSV DATINRFILS DDQLNRDNLN GQPSETPKNL NVIGRNLELT IVNNQLEFEK  120
MRYEELINGR KLREEDYKWL KLVDECGIQD LKRLLESLTG MRSNLYQMYD QVVVEVNNTR  180
NILESTYNLP PDMMGRDNGI STVFGGHPHQ MMMAGSSSNF DHSQMMMIQA PMSEFGDPSL  240
TMGSNGIAME HLLDANANAN ANANANANAN ANANANANGN GNGNANANAN ANANANANAN  300
ALSMPNPMGL AFPDPNLMPS FQGGNNPVGG SQFDGLPPLP SFNAQPMNPM NPMSGNFQNF  360
PSMLPGADVM DAPTVPFNPP NGFVFGNGNE FN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010690726.10.0PREDICTED: agamous-like MADS-box protein AGL62
STRINGXP_010690726.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.15e-42AGAMOUS-like 62