PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv8_182060_eqca.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family TCP
Protein Properties Length: 253aa    MW: 28650.1 Da    PI: 6.7843
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv8_182060_eqca.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP94.42.2e-2921102384
                 TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasn 84 
                         +kk rh k++T++g+RdRRvRlsa++a++f+d+qd+LG+ ++ ++++WL+ +a  +i++l +tss++ ++ ++   ++s+ +
  Bv8_182060_eqca.t1  21 AKKARHNKVYTAKGPRDRRVRLSADIAIQFYDVQDRLGYERATEAVDWLMSKARGSIDKLFETSSQQLEHLTNLGAQNSNTF 102
                         79*************************************************************6665544433333333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.8E-272195IPR005333Transcription factor, TCP
PROSITE profilePS5136926.5142280IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MSAAQKLVEV QAKHTMMRGS AKKARHNKVY TAKGPRDRRV RLSADIAIQF YDVQDRLGYE  60
RATEAVDWLM SKARGSIDKL FETSSQQLEH LTNLGAQNSN TFHGDYLVES SMSGREDYGV  120
ASFHHNCTTD GSMFFPCYHM ENGSQDQCNA DHSSFSASPC LRCLERSRIS YFQQIDDGKG  180
QIPRMFMFNS KLSLKNEEHP FLSNSVPLFL QPSEIKHYND LSSVHIPSDL DLSLCLPANC  240
LSSFHDSEQY TTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A5e-182780154Putative transcription factor PCF6
5zkt_B5e-182780154Putative transcription factor PCF6
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021846008.12e-77transcription factor TCP24-like
RefseqXP_021846009.12e-77transcription factor TCP24-like
TrEMBLA0A0K9R7995e-76A0A0K9R799_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31070.16e-30TCP domain protein 10